SecReT4
Protein ID: 197286426
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2579
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2818068..2819564 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDB4EXH8
KEGG IDpmr:PMI2579
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 7.7e-05, Aligned region: 367..472
Protein Sequence: 498 a.a.     [Download]
>gi|197286426|ref|YP_002152298.1| hypothetical protein PMI2579 [Proteus mirabilis HI4320]
MKVKSNTLVKILVPSALALAVLIGIKSCQPDTPVTGSGQDNLSQSINDLDPGELKSLGIEGDTPADTLRT
LIGTMKTVRDRQAELIAQNEKLLEENAQLRNRQQNVSGQIQSAVASVRQEAESQQRALQQEQQTLMRRLD
SLGETLTASGGQPAQGSGQGDIPLGLGLDTGGSGLTVKDGLLWAEPQDAQPAEPGRMVNGQPAKPAFPTS
FLEDNAITRQKAELDRVAKNQRTLSGTVDGEAHTEPAYTIPENATLVGSQAMTALLGRVPIDGKVTDPYP
FKVVVGKDNLTANGIELPDVEGAVISGSATGDWTLSCVRGDITSITFVFTDGTIRTVPKPADRTDGGSQA
NSGQNARNNGGSLGWISDESGIPCISGERKTNAGTYLPTLFALTAAASAGDAMSQSQYTAQNNGYGITSS
LSGDAGKAALGSAIGGGFKDVADWVKSRYGQTFDAVYVPPGQKVAVHISRQIPVDYESQGRRVNYGFSLT
EGEEGGLE
 
Nucleotide Sequence: 1497 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2819564-2818068 Proteus mirabilis HI4320 chromosome, complete genome
ATGAAAGTGAAATCCAATACGCTGGTCAAAATTCTGGTGCCGTCCGCACTGGCGTTGGCGGTGCTGATTG
GTATCAAAAGCTGCCAGCCCGACACGCCGGTCACCGGCAGCGGACAGGACAACCTGTCTCAGTCAATCAA
TGACCTTGACCCAGGGGAGCTGAAGTCACTCGGGATTGAGGGGGATACCCCGGCCGATACACTGAGGACG
CTGATTGGCACTATGAAAACGGTACGTGACCGTCAGGCGGAATTGATCGCCCAGAATGAGAAATTGCTGG
AAGAGAATGCGCAGCTGCGTAACCGGCAGCAGAATGTGTCGGGGCAGATCCAGTCTGCGGTGGCTTCCGT
CCGTCAGGAAGCGGAGAGTCAGCAGCGTGCCCTGCAACAGGAGCAGCAGACACTGATGCGGCGTCTGGAT
AGCCTGGGGGAAACGCTGACAGCATCAGGTGGTCAGCCGGCTCAGGGCAGCGGACAAGGCGATATTCCGC
TGGGACTGGGGCTGGATACCGGGGGCAGCGGACTGACGGTGAAAGACGGGTTGCTGTGGGCTGAGCCGCA
GGATGCACAACCGGCTGAACCGGGGCGGATGGTGAACGGACAACCGGCTAAACCGGCGTTTCCGACCTCT
TTTCTGGAGGATAACGCCATTACCCGTCAGAAAGCGGAACTGGACCGGGTGGCCAAAAATCAGCGCACGC
TCTCCGGTACAGTGGACGGTGAGGCCCATACCGAACCGGCGTACACGATACCGGAGAATGCCACCCTGGT
GGGCAGCCAGGCGATGACGGCGTTGCTGGGGCGGGTGCCCATTGACGGTAAAGTGACCGATCCGTATCCG
TTCAAGGTGGTGGTGGGAAAAGACAACCTCACGGCGAACGGCATTGAGTTACCGGATGTGGAAGGGGCGG
TGATCAGCGGCTCGGCCACCGGTGACTGGACATTGTCCTGTGTGCGCGGGGATATCACCTCGATCACCTT
TGTTTTTACGGACGGCACGATCCGCACGGTGCCGAAGCCGGCTGACCGGACGGACGGCGGCAGTCAGGCC
AACAGCGGACAGAATGCCCGTAATAACGGCGGGTCGCTCGGCTGGATTTCAGATGAGAGCGGGATCCCGT
GTATCAGCGGTGAACGTAAAACCAATGCCGGCACCTATCTGCCGACCCTGTTTGCCCTGACGGCAGCGGC
CTCGGCCGGGGATGCGATGTCGCAGAGTCAGTATACCGCGCAGAACAACGGGTACGGTATCACCTCCTCG
CTCTCCGGGGATGCGGGGAAAGCGGCGCTGGGCAGTGCCATCGGCGGCGGGTTTAAGGATGTGGCGGACT
GGGTGAAATCCCGCTACGGGCAGACCTTTGATGCGGTGTATGTGCCGCCGGGGCAGAAAGTCGCGGTGCA
TATCAGCCGTCAGATCCCGGTGGATTATGAATCGCAGGGACGCCGGGTGAATTACGGTTTTTCACTGACA
GAGGGTGAGGAAGGAGGTCTGGAGTGA