SecReT4
Protein ID: 197286427
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2580
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2819561..2820457 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDB4EXH9
KEGG IDpmr:PMI2580
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.3e-110, Aligned region: 20..287
Protein Sequence: 298 a.a.     [Download]
>gi|197286427|ref|YP_002152299.1| hypothetical protein PMI2580 [Proteus mirabilis HI4320]
MSIKRHLTACALGISAVFSVAALPLPVQAVELVRWERIPLPVSLHVGEERIVFVEKNVRVGFPPSLNEKL
RIQSTGGAVYLRAESAFPQTRLQLQDVESGEILLLDVTATAGKGKLEPVRVVYSGEVSTQRDSQSVRRSG
QAAGAAADAVPESVDRKAKTRYPAPLPVLLTRYAAQSLYAPLRTVEPVSGVQPLPLTLPKTLTALYPSEP
LIARPLAGWQAAEYRVVAVKLTNQSAQKVVLDPRQLQGQFVSATFQHQWLDAKGTPEDTTTVYLVMKGKP
DKAFPAEPPVRRTGGKAR
 
Nucleotide Sequence: 897 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2820457-2819561 Proteus mirabilis HI4320 chromosome, complete genome
ATGAGCATAAAACGTCATCTGACGGCCTGTGCTCTGGGGATTTCGGCGGTGTTTTCTGTGGCCGCTCTGC
CGCTGCCGGTGCAGGCGGTAGAGCTGGTCCGCTGGGAGCGTATTCCGTTACCGGTTTCTCTGCATGTGGG
GGAAGAGCGCATTGTGTTTGTGGAAAAAAATGTGCGTGTCGGTTTTCCACCGTCTCTGAATGAGAAACTG
CGGATCCAGAGTACCGGAGGGGCGGTGTACCTGCGGGCGGAAAGCGCCTTCCCGCAGACCCGCCTTCAGT
TACAGGATGTGGAAAGCGGGGAAATCCTGTTGCTGGATGTGACGGCCACTGCCGGTAAAGGGAAGCTGGA
GCCGGTGCGGGTGGTGTACAGCGGTGAAGTCAGTACGCAGCGTGACAGTCAGAGCGTCAGACGCAGCGGG
CAGGCTGCGGGGGCAGCAGCCGATGCCGTACCGGAAAGCGTGGACCGCAAAGCGAAAACCCGTTATCCGG
CGCCGTTACCGGTCTTACTGACCCGTTATGCCGCCCAGAGTCTGTATGCACCGTTAAGAACAGTGGAGCC
GGTGTCCGGCGTACAACCTTTGCCACTGACCTTACCAAAAACACTGACAGCACTCTACCCGTCTGAACCA
CTGATCGCGCGGCCGCTGGCCGGCTGGCAGGCGGCGGAGTACCGGGTGGTGGCGGTGAAACTGACCAATC
AGTCCGCTCAGAAAGTCGTGCTGGATCCCCGTCAGTTGCAGGGGCAGTTTGTCAGCGCCACGTTCCAGCA
TCAGTGGCTGGACGCGAAGGGCACACCGGAGGATACCACCACAGTGTATCTGGTGATGAAAGGCAAACCG
GATAAGGCGTTTCCTGCGGAGCCGCCTGTCAGGAGGACGGGAGGGAAAGCCCGATGA