SecReT4
Protein ID: 197286428
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2581
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2820454..2821098 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDB4EXI0
KEGG IDpmr:PMI2581
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.9e-88, Aligned region: 5..203
Protein Sequence: 214 a.a.     [Download]
>gi|197286428|ref|YP_002152300.1| hypothetical protein PMI2581 [Proteus mirabilis HI4320]
MSKFRHALQNRDQHILTLRMICGVLVLCLFVAFAGWMRAPAKLTIHNPPDLRSGSTRAWWEVPLPTVYAF
SFYIFQQLNAWPKDGEVDYPRKIAQLSAYLTPSCRAYFEKEAAYRTTLGELKGRSRVVYEIPGRGFSEDK
VRVIDRDNWIVRLDLVADEYFSAEPVKRATVRYPVKVVRWEGDPESNPFGLALDCYDGLPQRLEAAEQNK
EVSQ
 
Nucleotide Sequence: 645 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2821098-2820454 Proteus mirabilis HI4320 chromosome, complete genome
ATGAGTAAATTTCGTCATGCCCTGCAAAACCGGGACCAGCACATTCTGACACTGCGGATGATCTGCGGGG
TGCTGGTGCTCTGCCTGTTTGTGGCCTTTGCCGGCTGGATGCGGGCGCCGGCTAAACTGACGATCCATAA
TCCGCCGGATTTGCGCTCCGGCAGTACCCGGGCATGGTGGGAAGTGCCGCTGCCGACGGTGTACGCTTTC
AGCTTTTATATTTTTCAGCAACTGAATGCCTGGCCGAAAGACGGCGAGGTGGATTATCCGCGAAAGATTG
CACAGCTCAGTGCCTATCTGACGCCGTCCTGCCGGGCGTATTTTGAGAAAGAGGCCGCTTACCGTACTAC
GCTCGGGGAGCTGAAAGGGCGTTCCCGGGTGGTGTATGAGATCCCGGGACGCGGGTTCAGTGAGGATAAA
GTCCGGGTGATTGACCGGGATAACTGGATCGTGCGCCTGGATTTGGTAGCGGATGAATATTTTAGCGCGG
AGCCGGTCAAGCGAGCGACGGTACGTTATCCGGTGAAAGTGGTGCGCTGGGAGGGCGATCCGGAAAGTAA
TCCGTTTGGTCTGGCCCTGGACTGCTATGACGGGCTGCCTCAGCGTCTGGAAGCGGCGGAGCAGAATAAG
GAGGTCAGTCAATGA