SecReT4
Protein ID: 197286435
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2588
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2824071..2826218 [-]
Productplasmid transfer protein
Component typeTfc6
UniProt IDB4EXI7
KEGG IDpmr:PMI2588
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.5e-16, Aligned region: 504..633
TrwB_AAD_bind [PF10412], Evalue: 3.6e-13, Aligned region: 178..225
TrwB_AAD_bind [PF10412], Evalue: 3.6e-13, Aligned region: 506..643
AAA_10 [PF12846], Evalue: 9.4e-10, Aligned region: 187..580
Protein Sequence: 715 a.a.     [Download]
>gi|197286435|ref|YP_002152307.1| plasmid transfer protein [Proteus mirabilis HI4320]
MSDRYVIEAWLRPAVELNSALVSGGAAFVCAVAPWAVALSPSVSYVTAGAFAGFSALRAHQGFRVLRYRR
NLRRLPRYQVTSAQVPVSRQRLFLGKGFQWQQKHTQRLLETQRPEVERYVQPPAHYRLARQFELRFESRF
PAVCRLLQKDSWLNPVRPLTPVGGNPVLHGVEPDEVNVTMDLRERVGHMLVLGTTRVGKTRLAEVLITQD
IRRGNITIVFDPKGDADLLRRMWAEAHRAGRSEEFYVFHLGWPDISARYNAIGRFGRVSEVAGRVAGQLS
GEGNSAAFREFAWRFVNIIARALVALGERPDYAKILRYVTNIGELYQTYSMQVIKAQLPDLFAQIENAQN
ALTVEDVPRHLQSDPKAVAIWATELALSSEKGKKIYDPILDGLRSAIRYDRTYFDKIVASLLPLLEKLTT
GKTAALLSPDYTNMQDPRPIFDWQQVIRKKGIVYVGLDALSDAEVAAAVGNSMFADLVSVAGHIYKFGTQ
DGLPEDEHAGKLPISLHCDEFNELMGDEFIPLLNKSGGAGIEVTAYTQTWSDIEARLGNAAKSAQVTGNF
NTLVMLRVRELMTAKLLTEQLPEVDIYTKTLVSGITDISNPRQGSDFTSNTQDRVSMVAKPLLLPADIIQ
LPKGQAFALLEGGKLWKIRMPLPAAEADALMPPDLQKIAQYMEKNYRTGETWWTASSFSDARHDSGGMNV
AEMAPDTEGGNDGNC
 
Nucleotide Sequence: 2148 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2826218-2824071 Proteus mirabilis HI4320 chromosome, complete genome
ATGAGTGATCGTTATGTGATAGAGGCCTGGCTGCGACCGGCCGTGGAATTGAACAGTGCTCTGGTGTCCG
GCGGGGCGGCGTTTGTGTGTGCGGTAGCGCCCTGGGCAGTGGCATTGTCTCCGTCCGTGAGTTATGTCAC
CGCCGGTGCGTTTGCCGGTTTTTCCGCATTGCGGGCACATCAGGGATTCCGGGTATTACGTTACCGCCGG
AATCTCCGGCGTCTGCCCCGCTATCAGGTGACGTCGGCACAGGTGCCGGTCAGCCGGCAGCGTCTGTTTC
TGGGAAAAGGGTTTCAGTGGCAGCAAAAACACACGCAACGCCTGCTGGAAACCCAGCGTCCGGAAGTGGA
GCGGTATGTTCAGCCGCCGGCACATTACCGGCTGGCCCGGCAGTTTGAACTCCGTTTTGAATCCCGTTTT
CCGGCGGTTTGCCGGCTTTTGCAAAAAGACAGTTGGCTGAATCCGGTCCGCCCGCTGACGCCGGTGGGGG
GGAATCCGGTGTTACACGGTGTGGAGCCGGATGAGGTGAATGTGACCATGGATTTGCGTGAACGGGTTGG
TCATATGCTGGTACTGGGGACCACCCGTGTCGGCAAAACCCGTCTGGCGGAAGTGCTGATCACTCAGGAT
ATCCGCCGGGGGAATATCACGATTGTTTTTGATCCGAAAGGGGATGCGGATTTATTGCGCCGGATGTGGG
CGGAAGCGCATCGTGCGGGGCGCAGTGAGGAGTTTTATGTTTTTCACTTGGGCTGGCCTGATATCAGTGC
CCGTTATAACGCCATCGGGCGTTTTGGCCGAGTATCGGAAGTCGCGGGGCGGGTTGCCGGCCAGTTATCC
GGGGAAGGGAACAGCGCGGCGTTCCGGGAGTTTGCCTGGCGGTTTGTTAATATCATTGCCCGGGCACTGG
TTGCTCTGGGGGAGCGTCCGGATTATGCCAAAATTTTACGTTATGTCACCAATATCGGGGAACTCTATCA
GACATATTCGATGCAGGTGATTAAAGCACAACTACCTGATTTGTTTGCCCAAATCGAGAATGCGCAGAAC
GCGCTGACGGTCGAGGATGTGCCCCGTCATCTGCAAAGTGATCCGAAAGCTGTGGCTATCTGGGCAACGG
AGCTGGCGTTAAGTAGTGAGAAAGGGAAAAAAATCTATGATCCGATTTTGGACGGGCTGCGCAGTGCGAT
CCGTTATGACCGGACCTATTTTGATAAAATAGTGGCTTCTCTGCTGCCGTTACTGGAAAAACTGACTACC
GGAAAAACTGCCGCCCTGTTGTCGCCGGATTACACCAATATGCAGGATCCCCGTCCGATTTTTGACTGGC
AGCAGGTGATTCGGAAAAAAGGGATTGTATATGTCGGGCTGGATGCGTTATCGGATGCGGAAGTGGCGGC
AGCGGTGGGGAATTCCATGTTTGCGGATTTGGTCTCGGTAGCCGGGCATATTTATAAATTCGGGACTCAG
GATGGACTGCCGGAGGATGAGCACGCCGGAAAATTACCGATCAGCCTGCATTGCGATGAATTTAATGAAC
TGATGGGGGATGAATTTATTCCGTTACTGAACAAGAGCGGCGGCGCGGGGATTGAAGTGACGGCCTACAC
ACAGACCTGGTCTGATATTGAAGCCCGGCTGGGGAATGCGGCGAAATCGGCGCAGGTCACCGGTAACTTT
AATACGCTGGTGATGTTGCGTGTCCGTGAACTGATGACCGCGAAATTACTGACGGAACAGTTACCGGAAG
TGGATATTTACACCAAAACCCTGGTATCCGGGATCACCGATATTTCCAATCCGAGGCAGGGGAGTGATTT
TACCTCCAATACCCAGGACAGGGTCAGTATGGTGGCTAAACCGCTGCTGTTACCGGCAGATATTATTCAG
TTACCGAAAGGACAGGCGTTTGCGCTGCTGGAAGGCGGGAAGTTATGGAAAATCAGGATGCCCCTGCCGG
CGGCAGAGGCTGATGCCCTGATGCCACCGGATTTACAAAAAATCGCACAGTATATGGAGAAAAATTACCG
TACCGGCGAAACTTGGTGGACTGCGTCATCATTTTCGGATGCGCGGCATGACAGCGGCGGTATGAATGTG
GCTGAGATGGCACCGGATACCGAAGGGGGCAACGATGGCAACTGCTGA