SecReT4
Protein ID: 197286437
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2590
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2826574..2827128 [-]
Producthypothetical protein
Component typeTfc5
UniProt IDB4EXI9
KEGG IDpmr:PMI2590
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 4.7e-47, Aligned region: 37..179
Protein Sequence: 184 a.a.     [Download]
>gi|197286437|ref|YP_002152309.1| hypothetical protein PMI2590 [Proteus mirabilis HI4320]
MRNNPEEKTTRAFYPLPVLGMLLFCAAGGSQAALTVVADYGGQPAAPFYDAINNAPNEWTAKPASRPLPS
VMAPSMVLPVETPEMTPGEVDDRVLHLPGIGALYLVGDDPLSRAWLTQHAAQLNAMNAAGMVVNVKSETG
LQALQALAQGGLLSPASGTDLAHRLQLSHYPVLITETGLTQQVK
 
Nucleotide Sequence: 555 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2827128-2826574 Proteus mirabilis HI4320 chromosome, complete genome
ATGCGAAATAATCCTGAAGAAAAGACAACGCGAGCCTTTTATCCCCTGCCCGTCTTGGGGATGCTGCTGT
TTTGCGCAGCCGGCGGCAGTCAGGCGGCATTAACGGTGGTGGCGGATTATGGCGGGCAACCGGCAGCACC
TTTTTATGACGCGATAAATAATGCCCCGAATGAATGGACAGCAAAGCCGGCGTCCCGCCCTCTGCCGTCC
GTGATGGCCCCGTCAATGGTGTTGCCGGTTGAGACACCGGAAATGACGCCGGGGGAGGTGGATGACCGCG
TCCTGCATTTACCGGGGATTGGGGCACTGTATCTGGTGGGGGATGATCCGTTATCCCGGGCATGGCTCAC
ACAGCACGCAGCCCAGCTGAATGCAATGAATGCGGCCGGGATGGTGGTGAATGTGAAATCGGAAACCGGG
TTACAGGCGCTTCAGGCGCTGGCTCAGGGAGGACTGCTCTCCCCAGCTTCTGGCACCGATTTAGCTCACC
GTCTTCAGTTATCACATTACCCAGTTCTGATCACGGAAACCGGGTTGACCCAGCAGGTGAAGTAA