SecReT4
Protein ID: 197286439
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2592
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2827769..2828506 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDB4EXJ1
KEGG IDpmr:PMI2592
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 245 a.a.     [Download]
>gi|197286439|ref|YP_002152311.1| hypothetical protein PMI2592 [Proteus mirabilis HI4320]
MMKNIRCVVLLGGCLMSAPLTAAQSVSGATRPVQIEAGKSAESQTQSLQYEAQEWGLSAEEYARFEALMK
GRRGIQSPGLDPLTTLGIEARSDEERRRLAEKWVQQEFARAEKELAFQREVDAAWKRLYGQVLPVSLGTF
GRMEQGTAQRRQALFVQAENCSACDARLATLLAGKQPFDIYVLGTKGDDNRLRAWARQKNIPAERVRKRE
ITLNHDGGLSLQYGLTTTPVVMQQLPDGRWRPLTP
 
Nucleotide Sequence: 738 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2828506-2827769 Proteus mirabilis HI4320 chromosome, complete genome
GTGATGAAAAACATAAGATGCGTGGTTTTACTGGGTGGGTGTCTGATGTCCGCACCGCTGACAGCTGCAC
AGTCTGTTTCCGGGGCAACCCGACCGGTTCAGATTGAGGCGGGGAAATCGGCTGAGAGTCAGACACAGTC
ATTGCAGTATGAGGCGCAGGAATGGGGACTGAGTGCGGAGGAGTATGCCCGTTTTGAGGCGCTGATGAAA
GGGCGGCGCGGTATTCAGTCTCCCGGACTGGATCCCCTGACGACATTGGGTATTGAGGCCCGGTCAGACG
AAGAGCGCCGCCGGCTGGCTGAAAAGTGGGTACAGCAGGAATTTGCCAGGGCAGAAAAAGAGCTGGCGTT
TCAGCGGGAAGTAGATGCTGCCTGGAAGCGGCTCTATGGTCAGGTATTACCGGTCAGTCTGGGAACATTC
GGCAGGATGGAACAGGGAACAGCGCAGCGCCGGCAGGCACTGTTTGTGCAGGCGGAAAATTGTAGCGCGT
GTGATGCCCGTCTGGCTACTCTGCTGGCCGGCAAACAGCCGTTTGATATTTATGTGCTGGGGACAAAGGG
GGATGATAACCGCCTGAGGGCTTGGGCCAGACAAAAAAATATCCCGGCAGAGCGCGTCAGAAAGCGGGAA
ATTACGTTAAATCATGATGGCGGTCTCTCGCTTCAGTACGGACTGACCACCACACCGGTGGTGATGCAAC
AGTTACCGGATGGGCGGTGGCGTCCGCTCACACCTTAA