SecReT4
Protein ID: 197286441
T4SS name [ID]Tfc [686]
Gene symbol-
Locus tagPMI2594
StrainProteus mirabilis HI4320
Repliconchromosome [GenBank: NC_010554] [Browse all T4SS(s) in this replicon]
Location [Strand]2829254..2829916 [-]
Productconjugal transfer protein
Component typeTfc2
UniProt IDB4EXJ3
KEGG IDpmr:PMI2594
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 220 a.a.     [Download]
>gi|197286441|ref|YP_002152313.1| conjugal transfer protein [Proteus mirabilis HI4320]
MRMKTLPICLALTSLLLGGCADKPAQPTEAAADIAIPLNVGYAQPLLPDIYPSAPEVVRYDRYRLVDISP
SQAQRYPLEQIVHLRIPASVSPTVGDALHYALRDSGYRLCTSDGQANHLYRLPLPAVHYQMGSIRLNVAL
QILVGPAWQLWVDDVQREVCYRLRPEYTPSAPDAGMSGASSVSVVTPLSAGSTPLPVPPVLNTSTGHTDV
NKVHRGGWLK
 
Nucleotide Sequence: 663 bp     [Download]
>gi|197283915|ref|NC_010554.1|:c2829916-2829254 Proteus mirabilis HI4320 chromosome, complete genome
ATGCGTATGAAAACTCTCCCGATATGTCTTGCCCTGACCTCACTGTTGTTGGGGGGCTGTGCAGACAAGC
CAGCCCAGCCTACGGAAGCGGCGGCAGACATCGCGATTCCGCTCAACGTCGGTTATGCTCAGCCGCTGCT
CCCAGATATTTATCCGTCAGCCCCGGAAGTGGTGCGTTATGACCGTTACCGGCTGGTTGATATTTCGCCT
TCACAGGCACAGCGTTACCCGCTGGAACAAATTGTTCATCTGCGTATTCCTGCTTCCGTCTCCCCGACAG
TCGGGGATGCGCTACATTATGCCCTGCGTGATTCCGGATATCGTCTGTGCACGTCCGATGGACAGGCGAA
CCACCTTTATCGTCTGCCGTTACCCGCTGTTCATTATCAGATGGGATCGATCCGCCTGAATGTGGCGTTA
CAGATCCTTGTCGGTCCGGCCTGGCAGTTGTGGGTGGATGATGTGCAACGGGAAGTGTGTTACCGACTTC
GTCCGGAATACACGCCATCTGCGCCGGATGCAGGAATGAGCGGCGCTTCATCCGTCTCTGTGGTCACCCC
ACTTTCTGCGGGCAGTACGCCATTACCGGTGCCACCGGTGCTTAACACTTCCACTGGTCATACCGATGTG
AATAAGGTTCATCGCGGAGGGTGGCTGAAATGA