SecReT4
Protein ID: 208434447
T4SS name [ID]Cag [39]
Gene symbol-
Locus tagHPG27_484
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]519048..520040 [-]
ProductvirB11-like cag pathogenicity islandencoded protein / ATPase
Component typeCagalpha
UniProt IDB5Z6P8
KEGG IDhpg:HPG27_484
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.3e-55, Aligned region: 36..317
DEAD [PF00270], Evalue: 7.6e-05, Aligned region: 161..224
Protein Sequence: 330 a.a.     [Download]
>gi|208434447|ref|YP_002266113.1| virB11-like cag pathogenicity islandencoded protein / ATPase [Helicobacter pylori G27]
MTEDRLSAEDKKFLEVERALKEAALNPLRHATEELFGDFLKMENITEICYNGNKVVWVLKNNGEWQPFDV
RDRKAFSLSRLMHFARCCASFKKKTIDNYENPILSSNLANGERVQIVLSPVTVNDETISISIRIPSKTTY
PHSFFEEQGFYNLLDNKEQAISAIKDGIAIGKNVIVCGGTGSGKTTYIKSIMEFIPKEERIISIEDTEEI
VFKHHKNYTQLFFGGNITSADCLKSCLRMRPDRIILGELRSSEAYDFYNVLCSGHKGTLTTLHAGSSEEA
FIRLANMSSSNSAARNIKFESLIEGFKDLIDMIVHINHHKQCDEFYIKHR
 
Nucleotide Sequence: 993 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c520040-519048 Helicobacter pylori G27 chromosome, complete genome
ATGACTGAAGACAGATTGAGTGCAGAAGATAAAAAATTTCTAGAAGTAGAAAGAGCTTTAAAAGAAGCGG
CATTAAATCCTTTAAGGCATGCTACTGAAGAACTTTTTGGTGATTTTTTAAAAATGGAAAATATCACTGA
GATTTGTTACAATGGGAACAAGGTTGTATGGGTTTTAAAAAATAATGGCGAATGGCAACCATTTGATGTG
AGAGACAGGAAAGCCTTTAGTTTGTCTCGTTTAATGCATTTTGCTCGGTGCTGTGCAAGTTTTAAGAAAA
AAACAATAGACAACTATGAAAATCCTATTTTGAGCAGCAATTTAGCGAATGGTGAAAGGGTGCAGATTGT
CCTTTCCCCTGTTACAGTTAATGATGAAACCATTTCCATATCCATAAGGATACCTAGCAAAACAACCTAT
CCTCATAGCTTCTTTGAAGAGCAGGGTTTTTATAATCTACTAGATAACAAAGAACAAGCGATCAGTGCGA
TTAAAGATGGTATTGCTATTGGTAAAAATGTGATTGTTTGTGGTGGCACAGGAAGCGGTAAAACGACTTA
TATCAAAAGCATCATGGAGTTTATCCCCAAAGAAGAAAGGATCATATCCATTGAAGACACCGAAGAGATT
GTATTCAAACACCACAAGAACTACACGCAGCTTTTTTTTGGTGGGAATATCACCTCTGCTGATTGCTTAA
AGTCATGTTTGAGAATGCGACCTGATAGAATCATTTTAGGAGAACTCAGAAGCAGTGAGGCATACGATTT
TTATAATGTGCTTTGTAGCGGTCATAAAGGTACACTAACCACTCTGCATGCAGGGAGCAGTGAAGAAGCG
TTTATCCGTTTAGCCAACATGAGTTCATCTAATAGTGCAGCAAGGAATATCAAGTTTGAAAGTCTCATTG
AGGGCTTTAAAGATTTGATTGATATGATTGTTCATATCAACCACCACAAACAGTGTGATGAATTTTATAT
CAAACATAGGTAG