SecReT4
Protein ID: 208434460
T4SS name [ID]Cag [39]
Gene symbolcagI
Locus tagHPG27_498
StrainHelicobacter pylori G27
Repliconchromosome [GenBank: NC_011333] [Browse all T4SS(s) in this replicon]
Location [Strand]539957..541033 [-]
Productcag pathogenicity island protein I
Component typeCagI
UniProt IDB5Z6R1
KEGG IDhpg:HPG27_498
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 358 a.a.     [Download]
>gi|208434460|ref|YP_002266126.1| cag pathogenicity island protein I [Helicobacter pylori G27]
MITLEPALKAIQADAQAKQKTAQAELKAIEAQSNAKEKAIQAQIEGELRTQLATMSAMLKGANGVINGVN
SMTGGFFAGSDILLGVMEGYSSALSALGGNVKMIVEKQKINTQTEIQNMQIALQKNNEIIKLKMNQQNAL
LEALKNSFEPSVTLKTQMEMLSQALGSSSDNAQYIAYNTIGIKAFEETLKGFETWLKVAMQKATLIDYNS
LTGQALFQSTIYVPALSFFSSMGAPFGIIETFTLVPTKCPYLDGLKISACLMEQVIQNYRMIVALIQNKL
SDADFQNIAYLNGINGEIKTLKGSVDLNALIEVAILNAENHLNYIENLEKKADLWEEQLKLERETTARNI
ASSKVIVK
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|208433976|ref|NC_011333.1|:c541033-539957 Helicobacter pylori G27 chromosome, complete genome
GTGATAACGCTTGAACCCGCCTTAAAAGCCATTCAGGCGGACGCACAAGCCAAACAAAAAACCGCTCAAG
CCGAATTAAAAGCCATAGAGGCTCAATCTAATGCCAAAGAAAAAGCCATTCAAGCGCAAATAGAGGGAGA
ATTGAGAACCCAGCTTGCAACCATGAGCGCTATGTTAAAAGGGGCTAATGGCGTTATTAATGGTGTCAAT
AGCATGACAGGGGGGTTTTTTGCAGGTTCAGACATCTTGCTTGGCGTCATGGAAGGGTATTCAAGCGCGC
TTAGTGCATTGGGGGGGAATGTCAAAATGATCGTGGAAAAACAAAAAATTAATACCCAAACAGAAATCCA
AAACATGCAAATCGCACTCCAAAAAAATAACGAAATAATCAAGCTCAAAATGAACCAGCAAAACGCTCTC
TTAGAAGCGTTAAAAAACAGCTTTGAACCGAGCGTTACCCTAAAAACACAAATGGAAATGCTTTCTCAAG
CTCTAGGAAGTTCTTCTGACAACGCTCAATACATCGCTTACAATACGATTGGTATCAAGGCGTTTGAAGA
AACCTTAAAAGGTTTTGAAACATGGTTGAAAGTGGCTATGCAAAAAGCGACCCTTATTGATTATAATTCC
CTAACGGGTCAGGCTTTGTTTCAAAGCACCATCTATGTGCCTGCTCTTAGTTTTTTTTCAAGCATGGGCG
CACCATTTGGAATCATTGAAACATTCACTCTAGTACCCACAAAATGCCCCTATCTTGATGGGCTAAAAAT
TTCAGCATGCCTTATGGAACAGGTTATTCAGAATTACAGAATGATTGTAGCCCTTATTCAAAATAAACTG
AGTGATGCAGATTTTCAAAATATCGCTTATTTGAATGGGATCAATGGAGAAATCAAAACCTTAAAAGGAT
CAGTAGATTTGAACGCGCTCATAGAAGTTGCGATCTTAAACGCAGAAAATCATTTAAACTATATAGAGAA
TCTTGAAAAAAAAGCCGACCTTTGGGAAGAACAACTGAAATTAGAGAGAGAAACGACAGCAAGAAACATT
GCTAGCTCTAAAGTTATTGTCAAATGA