SecReT4
Protein ID: 209916892
T4SS name [ID]Tra_F [117]
Gene symbol-
Locus tagECSE_P2-0063
StrainEscherichia coli SE11
Repliconplasmid pSE11-2 [GenBank: NC_011413] [Browse all T4SS(s) in this replicon]
Location [Strand]45369..45902 [+]
Productconjugal transfer protein TraV
Component typeTraV_F
UniProt IDB6ICF5
KEGG IDecy:ECSE_P2-0063
PDB IDNA
Domain hit(s) vs Pfam TraV [PF09676], Evalue: 1.2e-23, Aligned region: 22..170
Protein Sequence: 177 a.a.     [Download]
>gi|209916892|ref|YP_002291212.1| conjugal transfer protein TraV [Escherichia coli SE11]
MKPALLMVLAGGLMLTGCAGMKSEFDCNDTASNGCMTMDEANNKARTMTENQKGKAAEGRRILPPLAAVP
VIKASATSAGGSPVTKNAAAAVTPGATARNPFRGSVAGTGGVAVTSGGAQISPVWSDIGMTRPVRLPSTT
ARMWIAAWVDDQAVWHQPSVVSFEVEPARWQHQEVKG
 
Nucleotide Sequence: 534 bp     [Download]
>ref|NC_011413.1|:45369-45902 conjugal transfer protein TraV [Escherichia coli SE11]
ATGAAACCTGCATTACTGATGGTTCTTGCCGGTGGCCTGATGCTGACAGGCTGTGCCGGCATGAAAAGTG
AATTTGACTGCAATGATACGGCCAGCAATGGCTGTATGACGATGGACGAGGCGAATAACAAGGCCCGTAC
CATGACTGAAAATCAGAAAGGAAAAGCCGCTGAAGGTCGCCGCATCCTGCCACCACTGGCTGCTGTGCCG
GTGATTAAGGCGAGCGCGACGTCTGCGGGGGGATCACCTGTGACAAAAAACGCCGCAGCAGCTGTTACTC
CGGGGGCAACAGCCCGCAATCCGTTCCGGGGGAGCGTTGCGGGAACAGGAGGTGTCGCTGTCACATCCGG
TGGCGCTCAGATTTCCCCGGTCTGGTCTGATATCGGCATGACGCGTCCCGTTCGTCTGCCGTCCACCACG
GCACGGATGTGGATAGCGGCCTGGGTGGATGATCAGGCGGTCTGGCATCAGCCGTCAGTCGTGTCCTTTG
AAGTGGAGCCTGCCCGCTGGCAGCACCAGGAGGTGAAAGGGTGA