SecReT4
Protein ID: 209916900
T4SS name [ID]Tra_F [117]
Gene symbol-
Locus tagECSE_P2-0071
StrainEscherichia coli SE11
Repliconplasmid pSE11-2 [GenBank: NC_011413] [Browse all T4SS(s) in this replicon]
Location [Strand]52166..52771 [+]
ProductTrbC protein
Component typeTrbC_F
UniProt IDB6ICG3
KEGG IDecy:ECSE_P2-0071
PDB IDNA
Domain hit(s) vs Pfam TrbC_Ftype [PF09673], Evalue: 3.4e-23, Aligned region: 85..182
Protein Sequence: 201 a.a.     [Download]
>gi|209916900|ref|YP_002291220.1| TrbC protein [Escherichia coli SE11]
MWKIVSVCSIAMTCMLSPGIVCASQDSAAFIESLRDQSDMLRRQATVPEFLQQPAPGKHNDAWIQSLTRK
SQQASARSKKTPRALYFLSFSIPEEGLIRMLPEARALGIPALVNGLIDNDFRKTAEAVFRITREKNTGGV
QIDPMQFAKYGITSVPALVVTCGERYDLIRGNIRLKAALERVAKEGECAPVAEAILRESER
 
Nucleotide Sequence: 606 bp     [Download]
>ref|NC_011413.1|:52166-52771 TrbC protein [Escherichia coli SE11]
GTGTGGAAGATTGTCTCTGTCTGCAGCATAGCCATGACCTGCATGCTGTCACCCGGCATTGTCTGTGCTT
CGCAGGACAGTGCGGCTTTTATTGAGTCCCTGCGTGACCAGAGTGATATGTTGCGCCGGCAGGCCACTGT
ACCGGAGTTTCTGCAGCAGCCAGCACCCGGAAAACATAACGATGCGTGGATACAGAGTCTGACCCGAAAA
TCACAGCAGGCATCCGCCCGCAGTAAGAAAACACCGCGTGCGCTGTATTTTTTGTCGTTCTCCATACCGG
AAGAAGGTCTGATTCGCATGCTGCCGGAGGCCAGGGCGCTGGGTATCCCCGCACTGGTTAACGGACTCAT
CGACAATGACTTCCGGAAAACAGCAGAGGCCGTATTCCGTATTACCCGGGAGAAAAATACCGGCGGTGTT
CAGATAGACCCGATGCAGTTTGCAAAATACGGCATCACATCCGTGCCGGCACTGGTGGTGACCTGTGGTG
AACGGTATGACCTGATTCGCGGCAATATCCGCCTGAAAGCGGCGCTGGAGCGGGTGGCGAAGGAAGGGGA
ATGTGCTCCGGTGGCTGAAGCGATTCTCAGGGAGAGTGAACGATGA