SecReT4
Protein ID: 209916905
T4SS name [ID]Tra_F [117]
Gene symbol-
Locus tagECSE_P2-0076
StrainEscherichia coli SE11
Repliconplasmid pSE11-2 [GenBank: NC_011413] [Browse all T4SS(s) in this replicon]
Location [Strand]56808..58214 [+]
Productconjugal transfer pilus assembly protein TraH
Component typeTraH_F
UniProt IDB6ICG8
KEGG IDecy:ECSE_P2-0076
PDB IDNA
Domain hit(s) vs Pfam TraH [PF06122], Evalue: 1.1e-106, Aligned region: 34..381
Protein Sequence: 468 a.a.     [Download]
>gi|209916905|ref|YP_002291225.1| conjugal transfer pilus assembly protein TraH [Escherichia coli SE11]
MNRKPSFLLRRVTLSCLVAAVLALPAQADVNNDLNKFFNKLGFEGNATRAAVWQGQAAGYATGGNLFLRN
QVNNLQIASFTPPHITAGCGGIDAYLGSFSFINSEQIERFVKQLMGNAVGYFFDLALQTAVPGMKSVKDF
MQKLASELNNMNISSCQAAQGIIGGLWPKNTVQSQKICQDIAGETNMFSDWAASRQGCTVGGQMNKVLDK
APENMKDQVMRNKNLMWEILKKNDMMNGNTELMELVMNVTGTLIFDDKGEIQFIGPQANHQGLIRALMYG
GQATIFGCTSTGDCLKTRNRTVTVSQNNSLNQRVQNMIKNISDKLVSDDPLTSQEKGFIESTSVPILRYL
VDPQMLNISTFYPSLSDYIAYDILLQYLNELLSQARVQAGSKNFPEEQMKMLRENFSEASRQLEGLQAQV
DVKANTLMELEQRMGYLRQQVSTQLMSRYEQNLNYTSVSSAQLTTGGN
 
Nucleotide Sequence: 1407 bp     [Download]
>ref|NC_011413.1|:56808-58214 conjugal transfer pilus assembly protein TraH [Escherichia coli SE11]
ATGAACCGAAAACCTTCTTTCCTGCTCCGGCGGGTAACGTTGTCATGTCTGGTTGCTGCTGTGCTGGCGT
TGCCTGCGCAGGCTGACGTCAATAACGACCTGAACAAATTCTTCAACAAGCTGGGCTTCGAGGGGAATGC
CACCCGCGCAGCTGTCTGGCAGGGGCAGGCGGCAGGCTATGCCACCGGCGGCAACCTGTTCTTACGCAAT
CAGGTGAATAATCTGCAGATAGCCTCCTTCACTCCACCGCATATTACCGCCGGTTGTGGTGGTATTGATG
CCTATCTGGGCTCCTTTTCCTTTATCAACAGCGAACAGATTGAGCGTTTTGTGAAGCAGCTGATGGGGAA
TGCCGTGGGGTACTTTTTTGACCTGGCGTTGCAGACAGCGGTGCCGGGCATGAAGTCAGTGAAGGATTTT
ATGCAGAAGCTGGCCAGTGAACTGAATAACATGAATATCTCCTCCTGTCAGGCCGCGCAGGGCATCATTG
GCGGTCTGTGGCCGAAGAACACCGTACAGTCGCAGAAAATCTGTCAGGACATTGCCGGTGAAACCAATAT
GTTCTCTGACTGGGCCGCCTCGAGGCAGGGATGCACGGTGGGCGGTCAGATGAATAAGGTGCTGGATAAG
GCGCCGGAAAACATGAAAGACCAGGTGATGCGTAATAAGAATCTGATGTGGGAGATTCTGAAGAAGAACG
ACATGATGAACGGTAACACCGAGCTGATGGAGCTGGTGATGAACGTTACCGGAACGCTGATTTTTGATGA
TAAAGGTGAAATCCAGTTTATCGGGCCACAGGCTAATCACCAGGGGCTTATCCGGGCGCTGATGTATGGC
GGACAGGCCACTATCTTTGGCTGTACATCCACGGGGGACTGTCTCAAGACACGCAACCGCACAGTGACGG
TCAGCCAGAACAACAGTCTGAATCAGCGTGTGCAGAACATGATAAAGAATATCTCTGACAAACTGGTCAG
TGATGACCCGCTGACCAGCCAGGAAAAAGGGTTTATTGAAAGCACCAGTGTGCCCATTCTGCGTTACCTG
GTGGACCCGCAGATGCTGAACATCTCCACTTTCTACCCGTCACTCTCTGATTACATTGCCTATGACATCC
TGCTGCAGTACCTGAACGAACTGCTGAGTCAGGCCCGGGTGCAGGCTGGCAGTAAAAACTTCCCGGAAGA
ACAGATGAAGATGTTACGGGAGAATTTCTCTGAAGCCTCCCGCCAGCTGGAAGGTCTGCAGGCTCAGGTG
GATGTGAAGGCGAACACACTGATGGAGCTGGAGCAGCGCATGGGCTATCTGCGTCAGCAGGTATCCACGC
AACTGATGAGTCGTTATGAGCAGAACCTGAACTATACATCTGTATCTTCTGCACAGCTGACGACAGGAGG
TAACTGA