SecReT4
Protein ID: 209922036
T4SS name [ID]Tra_I [169]
Gene symbol-
Locus tagECSE_P1-0084
StrainEscherichia coli SE11
Repliconplasmid pSE11-1 [GenBank: NC_011419] [Browse all T4SS(s) in this replicon]
Location [Strand]59247..61484 [-]
ProductTraY protein
Component typeTraY_I
UniProt IDB6IC52
KEGG IDecy:ECSE_P1-0084
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 745 a.a.     [Download]
>gi|209922036|ref|YP_002296109.1| TraY protein [Escherichia coli SE11]
MSPSPLIKSCVAFAHTQFYSGVTVKILLRALCAGLAISSLPAMASVTYQDIVSAATNPDDLSRQALVTIF
GDVVTNPLSTSAPTLIGSMFGAFNSIIAVLAVVWFMFIGIRHVVRSGHQGQVFSTGRDVVGTLSVVAGFL
MIVPTGNGWSLAQLIMLWGASIMGVGSANVMVQLAADNIANGYSMTVQPVQASTRTAARGIFEMELCKYA
VNAGLNDFNQTAKSSTSLMTESAKTASGNYTVTVSNGSGICGTASLSVEGNGTTEQSTIGKFFNPFSKNE
YSGVISAQRAAMDNMISDMDNAASEFVTTFLEKRNSGNGTLPDIETQIQKAADEYERAVQKSLPTDNGEQ
SRKEALKSYLTTYGWVTLGAWYQTFATANQRLAELADRAPAVTSMSSLGEVGDTDLFSAVMSAYRTQLQN
SSYTPPLGTVVSSSEQRMANAQDPKSALSEIMGPLVSLTNRIATETSGTGTTSAQINPLIKMKNIGDITM
VSAEGIWTIYTTARVVVAGGKDSILVKFFNSLTGAASMLTALFEALAPPVYFLLFLMFCAGFSLSIYLPF
IPFIFWMTGIGNWIVSVLIGCTAGPLWAATHLGTSEDRGSRAAYGYIYLIDSMIRPPIMVFGFFFASVAI
IAVGTILNALFGAALVNVQFNSLTGIFSLASFLLIYARMCTTTVAAIFALQAYLPDHVINFLGGRDGANT
LGSMANSVKEIFIGGSRNIRHTPGMKTDRLKDNTKGSDDKDGIKG
 
Nucleotide Sequence: 2238 bp     [Download]
>ref|NC_011419.1|:c61484-59247 TraY protein [Escherichia coli SE11]
ATGTCGCCATCCCCCTTAATTAAATCCTGTGTGGCCTTTGCCCATACGCAATTCTATTCCGGAGTTACTG
TGAAAATTTTACTTCGCGCACTCTGTGCAGGCCTTGCTATATCCTCACTGCCGGCAATGGCTTCAGTGAC
CTATCAGGATATTGTGTCTGCCGCAACCAATCCTGACGATCTGTCCCGTCAGGCGCTGGTCACGATATTC
GGTGATGTGGTCACCAATCCACTGTCAACCAGCGCCCCCACCCTAATCGGAAGCATGTTCGGGGCGTTCA
ACAGTATCATCGCCGTACTTGCCGTTGTCTGGTTTATGTTCATTGGTATCCGTCATGTTGTGCGTTCGGG
GCATCAGGGACAGGTATTCAGCACCGGACGCGATGTCGTCGGCACACTGAGTGTCGTTGCAGGTTTTCTG
ATGATCGTTCCAACCGGAAATGGCTGGAGTCTCGCTCAGCTCATTATGTTATGGGGCGCATCGATAATGG
GGGTTGGGTCCGCCAATGTGATGGTTCAACTTGCCGCTGATAATATCGCAAATGGTTATTCAATGACTGT
ACAGCCAGTTCAGGCATCCACACGAACAGCAGCGCGTGGCATTTTTGAAATGGAACTGTGTAAGTATGCG
GTTAACGCAGGACTAAATGATTTTAATCAGACGGCCAAATCCTCGACTTCACTGATGACAGAATCAGCTA
AAACCGCCAGTGGTAATTACACTGTCACGGTATCCAATGGCAGCGGTATCTGTGGTACAGCCAGCCTGTC
AGTAGAAGGAAACGGAACAACAGAACAATCGACGATTGGAAAATTCTTTAATCCCTTCAGTAAAAACGAG
TATAGCGGTGTTATCTCAGCACAACGTGCAGCCATGGATAATATGATTAGCGACATGGACAACGCTGCCA
GTGAGTTTGTGACAACATTTCTGGAAAAAAGAAATTCTGGCAACGGAACACTGCCGGATATCGAGACACA
AATTCAGAAAGCAGCCGACGAATACGAACGTGCTGTGCAAAAATCGCTACCCACTGATAACGGAGAGCAA
TCCAGAAAAGAGGCTCTTAAATCTTATCTCACAACCTACGGGTGGGTAACGCTTGGCGCATGGTATCAGA
CCTTTGCCACTGCTAACCAGCGTCTGGCAGAGCTGGCTGACAGAGCTCCAGCTGTAACTTCAATGTCATC
ACTGGGAGAAGTTGGTGATACTGACTTATTCAGTGCGGTCATGAGTGCCTATAGGACGCAACTGCAGAAT
TCCTCCTATACGCCACCGCTGGGCACAGTAGTATCATCCAGTGAACAACGCATGGCAAATGCACAAGATC
CGAAATCTGCCTTGTCTGAAATTATGGGCCCCCTTGTTAGTCTCACTAACAGGATTGCAACGGAAACAAG
TGGCACAGGCACAACCAGTGCTCAAATTAATCCTCTGATAAAAATGAAAAATATCGGAGATATAACAATG
GTAAGTGCAGAAGGAATCTGGACTATATATACAACGGCCAGAGTTGTCGTTGCCGGTGGCAAAGATTCAA
TTCTTGTAAAATTCTTTAACTCACTAACAGGTGCCGCTTCGATGCTTACCGCGCTGTTTGAAGCACTTGC
ACCACCTGTTTATTTTCTTTTGTTCCTGATGTTCTGTGCTGGATTTTCCTTATCAATTTACCTGCCATTC
ATTCCGTTTATTTTCTGGATGACAGGCATCGGGAACTGGATAGTCAGCGTATTAATAGGATGTACCGCCG
GGCCGCTGTGGGCTGCAACACATCTCGGGACATCAGAAGACAGAGGAAGTCGGGCAGCCTACGGTTATAT
ATACTTAATTGATAGTATGATAAGGCCGCCCATCATGGTCTTTGGTTTTTTCTTTGCTTCTGTAGCCATC
ATCGCCGTAGGCACAATACTGAATGCATTATTTGGCGCTGCCCTGGTTAACGTACAGTTCAATTCGCTGA
CCGGTATTTTCAGTCTTGCTAGTTTCTTGCTGATATACGCCAGAATGTGTACAACCACTGTAGCTGCCAT
ATTTGCCCTTCAGGCCTACCTACCTGATCATGTTATTAACTTCCTAGGGGGACGTGATGGAGCCAACACG
CTTGGCAGCATGGCAAATTCTGTTAAAGAAATATTTATTGGAGGAAGTCGCAATATCCGACATACTCCTG
GAATGAAAACAGATCGTCTTAAAGATAATACAAAAGGAAGTGACGACAAGGACGGAATAAAAGGATAA