SecReT4
Protein ID: 210134728
T4SS name [ID]Cag [35]
Gene symbolcagZ
Locus tagHPP12_0533
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]559215..559814 [-]
Productcag pathogenicity island protein Z
Component typeCagZ
UniProt IDB6JLA9
KEGG IDhpp:HPP12_0533
PDB IDNA
Domain hit(s) vs Pfam CagZ [PF09053], Evalue: 5.4e-138, Aligned region: 1..199
Protein Sequence: 199 a.a.     [Download]
>gi|210134728|ref|YP_002301167.1| cag pathogenicity island protein Z [Helicobacter pylori P12]
MELGFNEIERQKILDSNRSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDAYY
NYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFI
DGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
 
Nucleotide Sequence: 600 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c559814-559215 Helicobacter pylori P12 chromosome, complete genome
ATGGAACTCGGTTTTAATGAAATAGAAAGACAAAAGATCTTAGACAGCAACAGATCTCTTATGGGAAATG
CAAATGAAGTAAGGGATAAGTTTATTCAAAATTACGCCTCTTCTTTAAAAGATAGCAACGATCCGCAAGA
TTTTTTGAGAAGAGTTCAAGAATTAAGAATCAATATGCAAAAGAATTTTATTAGTTTTGATGCTTATTAC
AACTATTTGAACAACCTTGTGTTAGCCAGTTACAATCGTTGCAAACAAGAAAAGACTTTTGCAGAAAGCA
CGATCAAAAATGAACTAACGCTTGGGGAGTTTGTTGCAGAAATTTCTGACAACTTCAATAATTTCATGTG
TGATGAAGTGGCAAGAATTTCAGACCTAGTGGCTTCTTATCTGCCAAGAGAGTATTTACCGCCATTCATA
GATGGCAATATGATGGGCGTGGCGTTTCAGATTCTAGGGATAGATGATTTTGGGAGGAAGCTCAATGAGA
TTGTCCAAGATATAGGGACTAAATATATCATTTTGAGCAAAAATAAGACTTATCTCACTTCTTTAGAAAG
AGCTAAATTGATAACCCAGTTAAAATTAAATTTGGAATAA