SecReT4
Protein ID: 210134748
T4SS name [ID]Cag [35]
Gene symbolcagC
Locus tagHPP12_0553
StrainHelicobacter pylori P12
Repliconchromosome [GenBank: NC_011498] [Browse all T4SS(s) in this replicon]
Location [Strand]584430..584777 [-]
Productcag pathogenicity island protein C
Component typeCagC
UniProt IDB6JLC9
KEGG IDhpp:HPP12_0553
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 115 a.a.     [Download]
>gi|210134748|ref|YP_002301187.1| cag pathogenicity island protein C [Helicobacter pylori P12]
MKFFTRITDGYKKVVVTLGLVVTTNPLMAVTSPTTGVTETKTLVIQIISVLAIVGGCALGVKGIADIWKI
SDDIKRGQATVFAYAQPIAMLAVAGGIIYLSTKFGFNIGESGGAS
 
Nucleotide Sequence: 348 bp     [Download]
>gi|210134201|ref|NC_011498.1|:c584777-584430 Helicobacter pylori P12 chromosome, complete genome
ATGAAATTTTTTACAAGAATCACTGACGGCTACAAGAAAGTTGTAGTAACTTTAGGGCTAGTGGTAACAA
CCAATCCTTTAATGGCGGTCACCAGTCCTACAACAGGCGTCACTGAAACTAAAACTTTGGTTATTCAGAT
CATTTCTGTTCTAGCGATCGTAGGTGGTTGCGCTCTAGGGGTCAAAGGCATAGCGGATATTTGGAAAATC
TCTGATGACATCAAAAGAGGTCAGGCGACTGTTTTTGCTTACGCACAGCCCATAGCTATGTTAGCGGTGG
CAGGCGGTATTATCTATTTGAGCACTAAATTTGGCTTCAATATTGGCGAGAGTGGAGGAGCTAGCTAA