SecReT4
Protein ID: 215778351
T4SS name [ID]Tra_F [536]
Gene symboltraY
Locus tagVSAL_p840_01
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]111..281 [+]
Productconjugative transfer protein TraY
Component typeTraY_F
UniProt IDB6ESX2
KEGG IDvsa:VSAL_p840_01
PDB IDNA
Domain hit(s) vs Pfam TraY [PF05509], Evalue: 3.1e-21, Aligned region: 7..55
Protein Sequence: 56 a.a.     [Download]
>gi|215778351|ref|YP_002261491.1| conjugative transfer protein TraY [Aliivibrio salmonicida LFI1238]
MKKETSVNIVMDQKCNHLLNISKETSGRTKRNEAAARLKDHLLRFQHQDSWEVQKK
 
Nucleotide Sequence: 171 bp     [Download]
>gi|215778350|ref|NC_011311.1|:111-281 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGAAAAAAGAAACCTCAGTAAATATAGTCATGGACCAAAAGTGTAATCACCTATTGAATATATCAAAGG
AAACGAGTGGCAGAACAAAGCGTAATGAAGCTGCTGCACGATTAAAAGATCACCTTTTGCGCTTTCAGCA
CCAAGATTCTTGGGAGGTACAAAAGAAATAA