SecReT4
Protein ID: 215778352
T4SS name [ID]Tra_F [536]
Gene symboltraA
Locus tagVSAL_p840_02
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]423..704 [+]
Productconjugative transfer protein TraA, putative fimbrial protein precursor
Component typeTraA_F
UniProt IDB6ESX3
KEGG IDvsa:VSAL_p840_02
PDB IDNA
Domain hit(s) vs Pfam TraA [PF05513], Evalue: 1.8e-07, Aligned region: 22..88
Protein Sequence: 93 a.a.     [Download]
>gi|215778352|ref|YP_002261492.1| conjugative transfer protein TraA, putative fimbrial protein precursor [Aliivibrio salmonicida LFI1238]
MMKKWITPRNLLLTGTSVLLATQPALAADMFASGKTAIKDTVGTDSTVETAILSAGAVGAALTGFITKNW
IGAIGGFAVGMIFWSVVAPMVGL
 
Nucleotide Sequence: 282 bp     [Download]
>gi|215778350|ref|NC_011311.1|:423-704 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGATGAAAAAATGGATAACACCACGCAACCTCCTTCTGACTGGCACCAGTGTACTGCTCGCCACTCAAC
CCGCCCTGGCCGCCGATATGTTTGCCAGTGGCAAAACCGCCATTAAAGACACCGTTGGCACCGACTCCAC
CGTCGAAACCGCCATTCTCTCTGCCGGTGCCGTCGGCGCGGCATTAACCGGCTTCATCACCAAAAACTGG
ATAGGCGCCATCGGCGGCTTTGCCGTTGGGATGATTTTTTGGAGCGTTGTCGCCCCAATGGTCGGGCTCT
AA