SecReT4
Protein ID: 215778356
T4SS name [ID]Tra_F [536]
Gene symboltraB
Locus tagVSAL_p840_06
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]2337..3767 [+]
Productconjugative transfer protein TraB
Component typeTraB_F
UniProt IDB6ESX7
KEGG IDvsa:VSAL_p840_06
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.7e-35, Aligned region: 218..417
Protein Sequence: 476 a.a.     [Download]
>gi|215778356|ref|YP_002261496.1| conjugative transfer protein TraB [Aliivibrio salmonicida LFI1238]
MLNKWLKKSTNDATGSFEQGCLINERSIKRNGIITLVILVTLSTLGGVGYTVTRPSTPPPIERPPVDFGA
IIEDDFISADNQSALSAQQDTLHTQERTIAALKNEVNRVNAKLDNTVNLQEESFARFKDKMQATFERQRA
EMVLQKKEAPAQETDLSVAFGDKSLPPRAIPSSKHNPNAPEFSYQSADAPIFDTTGIDSYEFNWALSEEE
KPKRTILNYVPTGTFVTALVTGGADVNAGVLGQGDTVPMVFQTINAGILPNGQSSRLKDCTITGSSYGEI
SSSRGIVRTNRMSCIFDDGEIIDLAVKGTVFNFGRNGIRGTTILRNGKIVQMAGLSGILTGIGETGKALS
STTSVSALGSTSSLNGSDAALNLLGNATASVGAKLSDYYIQLAELYHPIVELNPGNVVNIVFLEGFPLDA
LGIEKYEAKQQVQESRSGNNQLLDVITNNPLANQLPQGVKAAMGAQTAPLTDFGSR
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|215778350|ref|NC_011311.1|:2337-3767 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGCTCAATAAATGGCTTAAAAAAAGCACCAACGACGCCACGGGCAGTTTTGAGCAAGGCTGCTTGATTA
ATGAGCGCAGCATCAAACGCAACGGCATCATTACACTGGTCATTCTTGTTACCCTTAGCACCCTGGGTGG
TGTCGGTTACACCGTCACTCGACCATCAACGCCCCCACCGATAGAGCGTCCTCCGGTGGACTTTGGCGCC
ATCATTGAAGACGACTTTATCAGTGCCGACAATCAATCGGCACTCAGTGCGCAGCAAGACACCCTTCACA
CCCAAGAGCGCACCATTGCGGCACTAAAAAATGAAGTCAATCGCGTCAACGCCAAACTGGACAACACCGT
GAACTTACAAGAAGAGAGCTTTGCTCGCTTTAAAGACAAGATGCAGGCGACCTTTGAGCGCCAACGCGCT
GAAATGGTGTTGCAAAAAAAAGAAGCGCCCGCTCAGGAGACGGACCTGTCCGTCGCCTTTGGTGATAAGT
CATTACCGCCTCGCGCCATTCCAAGCAGCAAGCACAACCCCAACGCCCCTGAGTTTTCTTATCAGAGCGC
GGATGCGCCCATCTTTGATACCACCGGCATTGACAGCTACGAGTTTAATTGGGCGCTCTCCGAGGAGGAG
AAACCCAAGCGCACCATTCTGAATTACGTTCCGACGGGCACCTTTGTCACCGCCTTGGTGACGGGCGGCG
CAGACGTCAATGCAGGAGTGCTTGGCCAAGGAGACACGGTGCCGATGGTATTTCAAACCATTAATGCCGG
AATATTGCCCAATGGGCAATCATCACGCCTTAAGGACTGCACCATCACCGGCTCAAGCTATGGCGAAATA
TCATCCAGTCGCGGGATAGTGCGCACCAATCGCATGAGCTGCATTTTTGATGACGGCGAAATCATCGATT
TGGCGGTGAAAGGCACGGTGTTTAATTTTGGTCGCAACGGCATTCGAGGCACCACCATTTTACGCAATGG
GAAAATCGTTCAAATGGCGGGACTCTCAGGCATTTTGACGGGCATTGGCGAGACAGGCAAAGCCTTGTCT
TCCACAACGTCCGTGTCCGCCCTTGGCTCGACCTCCAGTCTGAACGGCTCGGACGCGGCCTTAAATTTGT
TGGGCAATGCCACCGCCTCTGTGGGCGCTAAGCTCTCGGATTACTACATTCAACTGGCCGAGCTCTACCA
CCCGATTGTCGAATTAAACCCTGGCAATGTCGTGAACATTGTTTTTTTAGAAGGTTTTCCGTTGGACGCG
CTCGGTATTGAGAAGTACGAAGCCAAACAGCAAGTCCAAGAAAGTAGGTCCGGCAACAATCAACTGCTCG
ATGTCATCACCAACAACCCACTGGCCAATCAATTACCTCAAGGGGTAAAGGCCGCCATGGGCGCCCAAAC
CGCGCCACTGACCGATTTTGGCTCACGATAA