SecReT4
Protein ID: 215778363
T4SS name [ID]Tra_F [536]
Gene symboltraN
Locus tagVSAL_p840_13
StrainAliivibrio salmonicida LFI1238
Repliconplasmid pVSAL840 [GenBank: NC_011311] [Browse all T4SS(s) in this replicon]
Location [Strand]9821..11539 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB6ESY4
KEGG IDvsa:VSAL_p840_13
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1e-73, Aligned region: 296..531
Protein Sequence: 572 a.a.     [Download]
>gi|215778363|ref|YP_002261503.1| conjugal transfer mating pair stabilization protein TraN [Aliivibrio salmonicida LFI1238]
MNLSLSLLLILVLSPLALAGQEATFNAHLNWAKGATTSTQAKSEFALTPEDYCNDATCKTQLHAPQQTQL
SSSELESKAQAQYLTNEGAQAINDGFSKGRPSVENDPTYEFALLAQENAYEISHGLSNPFVDCTSGTLCS
LINVQKTCKAPTNTPLIYVQTPTLVTDIRPISTYSCPSGTRLQGNRCVYTERQCRYDRQNLVTKTTRKSR
EWCFSEGMSYRWNGKEVNRNGFSQGGSKKKYNTSRCKVQEYQICGSVTKSRSATAHCPSGYTLTGDHCSK
KIVTWPKSRPTGLISECQSTNNVCVEGSKTKIIDGIRVSLPCWKYETTYQCQTTNTCDALSECTNVSKTC
SLMQQGVCVEETLTKSCQEKSCQANTLQCGETSFCLDGDCYDATPTQSDDFHTSVSALAAISAAAEDLGE
PPTMFKGTAMKCEKKAAGINDCCKDSGWGQSLGMSCSPEEEALGKAKEGKLTIYVGQYCAKKILGVCTRK
KRSYCVYDSKLARIIQEQGTRHQLGLSNGSAKDPTCNPITPEQLQQINFEHLDFSDFYGDMNDNMALPSQ
NEIQSRLQNNVN
 
Nucleotide Sequence: 1719 bp     [Download]
>gi|215778350|ref|NC_011311.1|:9821-11539 Aliivibrio salmonicida LFI1238 plasmid pVSAL840, complete sequence
ATGAACCTCTCTCTCTCGCTGCTTCTTATCCTGGTACTCTCTCCTCTTGCCCTTGCAGGGCAAGAGGCCA
CGTTCAATGCCCACCTAAACTGGGCAAAAGGCGCAACCACAAGCACCCAAGCCAAGAGCGAATTTGCATT
AACACCAGAAGACTACTGCAACGACGCCACCTGTAAAACTCAACTGCACGCCCCACAGCAAACGCAGTTA
AGCAGCAGTGAATTAGAGAGCAAAGCCCAAGCGCAGTATCTCACCAACGAAGGGGCTCAAGCCATTAATG
ACGGGTTTTCAAAAGGGCGTCCAAGTGTAGAAAACGATCCAACGTACGAATTTGCACTCTTGGCGCAAGA
GAACGCGTATGAAATAAGCCATGGCCTGTCCAATCCGTTTGTGGACTGCACCTCTGGCACCCTTTGCTCG
CTCATTAATGTACAAAAAACCTGTAAAGCCCCGACCAATACGCCTCTCATTTATGTCCAAACCCCAACAT
TAGTGACTGATATTCGACCAATCTCCACCTACTCTTGTCCGTCAGGGACAAGACTGCAAGGAAATCGCTG
TGTTTATACTGAGCGTCAATGCCGATACGATCGACAAAATCTCGTCACAAAAACGACACGAAAAAGTCGA
GAATGGTGCTTTAGTGAAGGGATGTCTTATCGATGGAATGGAAAGGAAGTCAATCGTAATGGATTCTCCC
AAGGTGGGAGTAAAAAGAAATACAACACCTCACGCTGCAAGGTTCAAGAATATCAAATCTGTGGCTCAGT
CACCAAAAGCCGTAGCGCCACGGCGCACTGCCCTTCGGGTTACACCTTAACGGGCGATCATTGTTCAAAA
AAAATCGTGACGTGGCCAAAAAGCAGACCAACAGGTCTGATTTCAGAATGCCAATCAACCAACAACGTCT
GTGTCGAAGGAAGTAAAACAAAAATCATTGATGGCATTCGCGTCAGCCTTCCTTGCTGGAAGTACGAGAC
CACGTACCAATGCCAAACCACCAATACGTGTGACGCCCTCAGCGAGTGCACCAACGTCAGTAAAACATGC
AGCCTGATGCAGCAAGGCGTCTGCGTTGAAGAAACCCTGACCAAATCATGCCAAGAAAAATCCTGTCAAG
CCAACACATTGCAGTGCGGTGAAACCAGTTTTTGTCTCGATGGCGATTGCTACGACGCCACGCCGACCCA
AAGCGATGACTTTCACACCTCCGTCTCTGCCCTTGCGGCCATTTCCGCCGCCGCCGAAGACTTGGGTGAG
CCACCGACCATGTTCAAAGGCACCGCCATGAAGTGTGAGAAAAAAGCCGCGGGGATCAATGACTGCTGCA
AAGATTCAGGCTGGGGACAAAGCCTTGGCATGAGTTGCAGTCCAGAAGAGGAAGCGCTAGGCAAAGCCAA
AGAAGGCAAGCTCACGATTTATGTCGGTCAATATTGCGCGAAAAAAATCCTCGGCGTCTGCACCAGAAAA
AAACGCAGTTACTGCGTTTATGACAGCAAGTTGGCGCGAATAATCCAAGAGCAAGGCACGCGACATCAAC
TGGGCCTCAGCAATGGCTCGGCCAAAGACCCAACGTGCAACCCCATCACGCCTGAGCAACTGCAACAGAT
TAATTTTGAACACTTGGATTTTTCCGATTTTTACGGGGACATGAACGACAACATGGCCTTACCAAGCCAA
AACGAGATCCAATCTCGCTTACAAAACAACGTGAATTAA