SecReT4
Protein ID: 217975596
T4SS name [ID]Tra_F [535]
Gene symbol-
Locus tagSbal223_4383
StrainShewanella baltica OS223
Repliconplasmid pS22301 [GenBank: NC_011664] [Browse all T4SS(s) in this replicon]
Location [Strand]49204..51006 [+]
Productconjugal transfer mating pair stabilization protein TraN
Component typeTraN_F
UniProt IDB8EFP6
KEGG IDsbp:Sbal223_4383
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 3.6e-69, Aligned region: 313..555
Protein Sequence: 600 a.a.     [Download]
>gi|217975596|ref|YP_002360266.1| conjugal transfer mating pair stabilization protein TraN [Shewanella baltica OS223]
MTQLNNALILSAILTLSAALPVVAANSEKDYRNNVQWAKDSIKQNQNKAGYTGFDVNSLCKDATCQQEVA
NPSESRYYNNPSAMDSAKMQGMSTDGQAQAVTSGFNKGRPTIDENDPAYHTAVGYQNDAYNISHGISSKY
HDCEKGLVCEVDSQPRSCTLPTNNPVQCYLTPFVKHSSMTTKEYDFQLLYASLPYTFALEEPVALSSVRI
SGRFSISQFTTVIRFYIDDTLLGEVPVIPEKCSMTTCSVQINSQFTYPVASESSSYVFKMKYMFLGDVGY
DVGLVDKAQVTLVTNKTSVEVGYNNSCGAVLPECQQVQSQCIEGKETRMINGISVTLDCWKEQTTYQCAF
PNTCDAIADCSIQSTSCDTQLGGVCIKDKQQRLCDKQQCRDTGLICGADSFALSGDYYDPAATRSTDFNH
AAAGLAAVSDAAGDVKDKANINEDSAIIFKGNIMECSDKALGISNCCQDSGWGNGIGLTSCSEEEKALGT
AKEDKLTVSLGQYCAEKVLGVCIRKKKAYCAFDSKLARIVQVEGRAQLGKNFGSAKHPDCSAFSPNELQR
IDMSSMDFSDFYEDMYDAIELPSTDEIQKRLQQSVGGTKP
 
Nucleotide Sequence: 1803 bp     [Download]
>gi|217975547|ref|NC_011664.1|:49204-51006 Shewanella baltica OS223 plasmid pS22301, complete sequence
ATGACTCAGTTGAATAATGCCTTAATCCTCAGTGCCATCCTCACATTGAGCGCCGCCTTGCCTGTTGTGG
CGGCAAACAGCGAAAAAGACTATCGCAACAATGTGCAGTGGGCCAAAGACAGTATCAAGCAGAATCAGAA
CAAAGCGGGTTACACCGGTTTTGACGTTAACAGCCTATGCAAAGATGCGACATGCCAGCAAGAAGTCGCC
AATCCGAGCGAAAGCCGTTACTACAACAACCCGAGCGCCATGGACAGCGCCAAAATGCAAGGCATGAGCA
CGGATGGTCAAGCCCAAGCAGTGACGAGCGGCTTTAACAAGGGACGCCCGACGATCGATGAAAACGATCC
GGCATACCATACCGCCGTCGGCTATCAAAATGATGCTTACAATATCAGTCACGGCATTTCATCTAAATAT
CATGACTGTGAAAAAGGGCTCGTTTGTGAGGTCGATTCTCAGCCACGCTCGTGTACTTTGCCCACCAACA
ATCCGGTGCAATGCTACCTGACGCCCTTTGTTAAACACTCGTCGATGACGACTAAAGAGTATGACTTCCA
ACTGTTATATGCGTCACTACCTTACACCTTCGCACTTGAAGAGCCTGTAGCGCTCAGTAGTGTTCGTATT
TCAGGCCGCTTCAGCATTTCGCAATTTACAACAGTCATACGCTTTTATATCGACGATACCCTGCTTGGAG
AAGTACCCGTTATACCGGAAAAATGTTCGATGACGACATGTAGCGTACAGATTAATAGTCAATTTACTTA
CCCAGTCGCCAGTGAAAGTAGTTCATACGTTTTTAAGATGAAGTACATGTTCTTAGGGGACGTCGGGTAT
GACGTTGGTTTAGTAGACAAAGCGCAGGTGACATTAGTCACAAATAAAACCTCCGTAGAAGTAGGCTACA
ACAACAGTTGCGGCGCAGTCCTCCCCGAGTGCCAACAAGTTCAATCTCAATGTATTGAGGGTAAAGAAAC
GCGCATGATTAATGGGATCAGCGTGACATTGGATTGCTGGAAAGAACAAACCACCTATCAATGTGCCTTT
CCCAATACCTGCGACGCCATCGCTGATTGCAGCATTCAATCGACCAGTTGTGACACCCAACTTGGCGGCG
TTTGCATTAAAGATAAACAACAACGCCTATGTGATAAACAGCAATGCCGAGATACGGGCCTTATCTGCGG
TGCAGACAGCTTTGCGCTCAGTGGTGACTATTACGATCCTGCGGCCACTCGTAGCACTGACTTTAACCAT
GCTGCGGCAGGACTGGCCGCCGTCAGTGACGCAGCCGGTGATGTGAAAGACAAGGCCAACATCAACGAAG
ACAGCGCCATCATTTTCAAAGGCAACATCATGGAGTGCAGCGATAAAGCGCTGGGGATCAGCAATTGTTG
TCAGGACAGCGGTTGGGGTAACGGCATCGGCTTAACGTCCTGCAGTGAAGAAGAAAAAGCGCTGGGTACC
GCAAAAGAGGACAAGCTCACCGTATCACTTGGCCAATATTGTGCTGAGAAAGTGCTTGGCGTGTGTATCC
GCAAGAAAAAAGCCTATTGCGCGTTTGATAGCAAACTCGCGCGCATTGTGCAGGTTGAGGGTCGCGCGCA
ATTGGGCAAAAACTTCGGCAGCGCCAAACATCCTGATTGCAGCGCCTTTTCACCTAACGAACTGCAACGC
ATTGATATGTCGTCAATGGACTTTTCTGATTTTTATGAAGACATGTACGACGCCATCGAACTGCCCAGCA
CAGACGAAATTCAAAAACGCTTACAACAGTCGGTTGGAGGAACCAAACCATGA