SecReT4
Protein ID: 218534620
T4SS name [ID]Tra_I [182]
Gene symbol-
Locus tagpGDT4_0005
StrainYersinia pseudotuberculosis plasmid pGDT4 (NC_011759)
Repliconplasmid pGDT4 [GenBank: NC_011759] [Browse all T4SS(s) in this replicon]
Location [Strand]5826..7142 [+]
ProductTraO protein
Component typeTraO_I
UniProt IDB7UEZ6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 438 a.a.     [Download]
>gi|218534620|ref|YP_002424382.1| TraO protein [Yersinia pseudotuberculosis]
MIIEKEAASDTRKSVAIIGIGVITALCVIYLGYSWLNSPPVARSVYDINKVATNAGRTITESPEYRELLE
KYNTEKAAKARQEGKSFVAQIRQGSEGAGTKTLTTPQSVILNQTPPATTAGAAQAQQQAPPFSENRKKAI
DALLKELNSHWSPVGFQLASATGGNGGAAGQEQTGAFSQWTSSLSSPTPSRQSFDDSNMPDIQLIPPYTR
TPGVIETAVDSDNPGSQVIARIPAGPYAGAMLHASSVQLAGDGVNIHFTRMAWGGETYTVDAYALSDETL
QSSVASNVNNRYFSRIILPALAMGIGRTGQLYEQANSQNIITPQGGVIQTSTGTPNGSAVAGTIVGGIGS
QAGQVMASDAARLPVKQATVEPNQVIAIQFIGGVYQSDNIRSKSGQQKIQQQTQAQPHQLTSQPPPVTAQ
PTTLNRTPSPYTPRYDNR
 
Nucleotide Sequence: 1317 bp     [Download]
>gi|218534615|ref|NC_011759.1|:5826-7142 Yersinia pseudotuberculosis pGDT4 plasmid
ATGATCATTGAAAAAGAGGCTGCCAGTGATACGCGTAAATCTGTTGCGATCATCGGTATCGGCGTTATCA
CCGCGTTATGTGTGATTTATCTGGGTTACAGCTGGTTAAACTCCCCTCCCGTAGCCCGGTCTGTTTATGA
CATAAATAAAGTAGCAACCAATGCGGGGCGCACAATAACAGAAAGCCCGGAATATCGGGAATTACTGGAG
AAATACAACACAGAAAAAGCAGCAAAAGCCCGTCAGGAGGGGAAGAGTTTTGTTGCTCAAATCCGTCAAG
GCTCTGAAGGGGCTGGGACCAAAACACTGACCACCCCGCAATCGGTCATACTGAATCAAACGCCACCGGC
AACGACGGCTGGCGCGGCACAAGCACAGCAACAAGCTCCCCCCTTCAGTGAGAACCGCAAGAAAGCCATC
GACGCACTGCTAAAGGAGTTGAACTCACACTGGTCCCCAGTGGGGTTTCAACTGGCATCAGCGACAGGAG
GCAATGGGGGGGCTGCTGGTCAGGAGCAAACGGGGGCATTTTCACAGTGGACCTCAAGCCTGTCATCACC
CACACCCTCCCGGCAATCCTTCGATGACAGTAATATGCCTGATATCCAGCTGATACCGCCTTATACCCGA
ACGCCGGGAGTAATTGAAACAGCTGTCGACTCCGATAACCCGGGATCACAAGTTATCGCCCGCATCCCAG
CCGGGCCATATGCAGGCGCAATGTTGCATGCCAGTAGCGTTCAGTTGGCGGGAGACGGCGTGAATATTCA
CTTCACCCGGATGGCCTGGGGTGGCGAAACCTACACGGTCGACGCCTATGCGTTGAGCGATGAAACACTT
CAATCCTCGGTCGCCAGTAACGTCAATAATCGCTATTTTTCACGCATTATTTTACCCGCGCTGGCGATGG
GGATTGGCCGCACGGGTCAGCTTTATGAGCAGGCTAATTCACAAAACATCATTACCCCTCAAGGGGGGGT
TATTCAAACCAGCACCGGTACTCCCAATGGTTCAGCGGTTGCCGGTACGATTGTAGGCGGGATCGGAAGT
CAGGCAGGCCAGGTAATGGCCAGTGATGCCGCCCGTTTACCGGTAAAACAAGCCACTGTTGAGCCCAATC
AGGTTATTGCTATCCAGTTTATTGGCGGAGTTTATCAGAGTGATAATATTCGCAGCAAAAGTGGCCAACA
AAAAATTCAGCAACAAACCCAGGCACAACCACACCAACTCACATCCCAGCCGCCCCCAGTAACAGCGCAG
CCAACAACCTTGAATAGAACACCGAGCCCGTACACCCCGCGCTATGACAATCGTTAA