SecReT4
Protein ID: 218667164
T4SS name [ID]Tra_F [558]
Gene symbol-
Locus tagAFE_1097
StrainAcidithiobacillus ferrooxidans ATCC 23270
Repliconchromosome [GenBank: NC_011761] [Browse all T4SS(s) in this replicon]
Location [Strand]988768..991827 [+]
Productconjugal transfer protein TraN
Component typeTraN_F
UniProt IDB7J845
KEGG IDafr:AFE_1097
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1.5e-25, Aligned region: 593..692
TraN [PF06986], Evalue: 1.5e-25, Aligned region: 860..939
Protein Sequence: 1019 a.a.     [Download]
>gi|218667164|ref|YP_002425569.1| conjugal transfer protein TraN [Acidithiobacillus ferrooxidans ATCC 23270]
MGFFIWMGHPKRQRRAGALFIAWMAALGVIYEATATANAGTFINQAQSGADLGNTLLLGGQTDAAGNAGG
QEMQGFAGTQPAGVENNASSYYLSDNVGLTPGNALNQASAANTAVLSDPTCPSGWPGPLNQFQQQGMGAV
ASTQNACKGPLQAAATSLTQAMAGTSGSTLAAYQGAQQSIQTFGQELSQVNSAGNALETTCAPVINGYYQ
YAPACNLLSVSGVPSLGTLAAAWAGPLGTVASGCAALPTAITSPAAAQSLENALAPLTADLQGIIGGATG
SVYANGNGDGAAILTGGYGSGAVTAASQEYQQIYGQCSYAQSYLENISTYPGGMNAYASDPMLNNFLSNP
ANQGMINQMMPFIESNPNVFSQYYQNVACTNNNVNITNAGTSATGPSTTTTSAPSIQSSPVACTEPLSAY
TSTGWIDAADWPDPNAQWIYGTAGGCGAGVPNGTTDLMEGVYSNTTGAPLNATLYLAADDEGVVDINGTQ
VATYSDGGQGGDGAAAYPSTGGVVSVPITLSPGPDQIMYYITNAGGGTAANPSSGILTIIGTVNGTSQVL
IDTNSNWVYVPQNAAQAGSTVTVNPGSVTTNTTPNTHAQSILCNSPIQCMGTECHALFGNQDLQFSQALT
ALSALQQMEQGAVCATGTSMAAGNCQPIIFGGTADYCRTWPAGGVFTNNCCAQGLQDAGQSGNLASYLEL
AHDTWKIANAPIVDAHVWGMKAFHSWVEGAYSTMDQWAAQGWGYVVTAFRGAADAVAQAFGQVGPYAFHD
CGILSNSVFTSPPATKGLETAMENEIKGWLETAAKWVLKKIFGKAIEKEVMTFLASKIAEKIGSYAADAA
SIIGWVYLAYQVLQIIGNLLTACKNEEFKLGQKRKLHACQNLGTYCTDKFLGFCLEHKDVFCCYASPLSR
IIAAQIKIGQPNVAGGYGTPQDPQCGGFTVQQLAAVDWSEVSLAQWQALLQSAGLIAGGNAQGSAIYTPA
QIDHPGGDVNIEQAPIPVGHSGTPVTPVPMPTINPNASP
 
Nucleotide Sequence: 3060 bp     [Download]
>gi|218665024|ref|NC_011761.1|:988768-991827 Acidithiobacillus ferrooxidans ATCC 23270 chromosome, complete genome
ATGGGCTTTTTCATCTGGATGGGGCACCCCAAACGCCAGCGCCGCGCCGGCGCGTTGTTCATCGCCTGGA
TGGCGGCGTTGGGGGTCATTTACGAGGCTACCGCAACCGCCAATGCCGGTACGTTCATCAACCAAGCGCA
AAGCGGAGCGGATCTCGGCAACACTTTGCTTCTGGGCGGACAAACCGATGCCGCCGGCAATGCCGGTGGT
CAGGAGATGCAAGGTTTCGCCGGCACTCAGCCAGCGGGTGTGGAGAATAACGCTTCTTCCTATTACCTGT
CGGACAATGTGGGGCTGACGCCAGGGAACGCGCTCAATCAGGCCAGCGCCGCCAACACGGCGGTTTTGAG
TGATCCGACTTGTCCCTCTGGTTGGCCGGGACCGCTCAATCAGTTCCAGCAGCAGGGCATGGGTGCGGTG
GCCTCCACCCAGAACGCCTGCAAAGGCCCCTTGCAGGCCGCAGCGACCTCCCTGACGCAAGCTATGGCCG
GAACCAGTGGAAGCACGCTGGCGGCATATCAGGGCGCTCAACAATCCATCCAGACGTTTGGGCAGGAACT
TAGCCAGGTCAACAGCGCGGGCAACGCCCTGGAAACCACCTGCGCGCCGGTGATCAACGGGTACTATCAA
TACGCGCCAGCCTGCAACCTCTTGAGCGTGTCCGGGGTGCCTTCCTTGGGGACGCTGGCCGCCGCCTGGG
CGGGGCCGCTGGGTACCGTGGCGTCCGGGTGCGCGGCGCTGCCCACGGCCATCACCAGCCCTGCGGCGGC
GCAGAGCCTGGAGAACGCACTGGCGCCGCTGACCGCAGACCTGCAAGGGATCATCGGCGGCGCGACGGGA
AGCGTCTACGCCAATGGCAATGGAGATGGTGCGGCCATCTTGACCGGGGGGTATGGGAGCGGCGCCGTCA
CGGCAGCGTCCCAGGAGTACCAGCAGATATACGGGCAATGCAGCTATGCCCAATCCTATCTGGAAAACAT
CTCCACCTACCCGGGCGGCATGAACGCCTATGCCAGCGACCCGATGCTCAACAACTTCCTGAGCAATCCG
GCGAATCAGGGCATGATCAACCAGATGATGCCTTTTATCGAGAGCAACCCCAACGTCTTCAGCCAGTATT
ACCAGAACGTCGCCTGCACAAACAACAACGTCAACATTACCAATGCCGGGACATCCGCGACAGGGCCTAG
CACGACCACGACCAGCGCGCCGTCGATCCAGTCCAGTCCGGTCGCCTGTACGGAACCGCTCTCGGCTTAT
ACCAGTACCGGCTGGATCGATGCCGCTGACTGGCCTGACCCCAATGCACAATGGATCTACGGAACAGCCG
GAGGATGCGGGGCCGGAGTGCCCAACGGCACGACGGATCTCATGGAGGGAGTGTATTCCAATACCACGGG
CGCGCCCTTGAACGCCACGCTGTACCTGGCGGCCGACGATGAAGGTGTAGTGGACATCAACGGCACGCAG
GTGGCGACCTACTCGGATGGGGGGCAAGGCGGCGATGGAGCGGCGGCCTATCCTTCGACCGGAGGTGTGG
TTTCCGTGCCGATCACGCTGAGTCCGGGGCCGGACCAGATCATGTACTACATCACCAATGCTGGTGGCGG
CACGGCGGCCAATCCATCATCGGGCATCCTCACCATCATCGGCACCGTGAACGGCACCAGTCAGGTGCTG
ATCGACACCAACAGCAATTGGGTCTATGTACCGCAAAACGCGGCGCAAGCGGGGTCAACCGTCACCGTCA
ACCCCGGGTCCGTGACGACCAACACCACGCCGAACACGCATGCCCAGAGCATCCTGTGCAATAGCCCGAT
CCAATGCATGGGCACGGAATGCCACGCCCTGTTCGGCAACCAGGACCTGCAATTCAGCCAGGCGCTCACG
GCCCTGTCCGCGTTGCAACAAATGGAGCAGGGGGCCGTCTGCGCAACCGGTACGTCTATGGCGGCAGGCA
ATTGTCAGCCGATCATTTTTGGCGGTACTGCCGACTATTGCCGGACCTGGCCGGCCGGTGGGGTATTCAC
GAATAACTGCTGCGCACAAGGGTTGCAGGATGCAGGGCAATCCGGAAACTTGGCAAGTTACCTTGAGCTC
GCTCACGACACATGGAAGATCGCCAATGCACCGATTGTAGATGCGCATGTCTGGGGTATGAAAGCATTCC
ATAGTTGGGTGGAAGGCGCCTACAGCACCATGGATCAATGGGCGGCTCAAGGCTGGGGTTATGTGGTCAC
AGCTTTTAGGGGCGCGGCTGATGCTGTGGCGCAAGCCTTTGGTCAGGTTGGACCATATGCGTTCCACGAC
TGTGGCATCCTAAGCAATTCAGTCTTTACTTCACCTCCTGCTACCAAAGGGCTGGAGACTGCAATGGAGA
ACGAAATAAAGGGATGGTTAGAAACTGCTGCAAAATGGGTATTGAAAAAGATTTTTGGGAAAGCAATTGA
AAAGGAGGTAATGACGTTCCTTGCTTCAAAAATAGCAGAGAAAATTGGAAGTTATGCTGCAGACGCCGCG
AGTATTATAGGATGGGTTTATTTGGCATACCAAGTTTTGCAAATTATTGGTAATCTCCTGACCGCATGCA
AAAACGAAGAGTTTAAACTCGGACAGAAGCGCAAACTCCATGCTTGCCAGAATCTGGGGACCTATTGCAC
GGATAAATTTTTGGGCTTCTGTCTGGAGCACAAGGACGTGTTCTGCTGCTACGCGAGTCCGCTTTCACGG
ATTATTGCGGCGCAAATCAAGATCGGTCAGCCCAACGTCGCCGGGGGTTATGGCACCCCCCAGGATCCCC
AGTGCGGCGGATTCACGGTGCAGCAGCTTGCGGCAGTGGACTGGTCTGAGGTTTCCTTGGCGCAATGGCA
AGCATTGCTGCAGAGCGCAGGATTGATTGCGGGGGGTAATGCTCAAGGATCAGCCATCTATACGCCGGCG
CAAATCGATCATCCAGGCGGTGATGTAAATATTGAGCAGGCACCGATACCGGTTGGCCATTCTGGCACGC
CGGTAACACCAGTGCCAATGCCAACGATAAACCCCAATGCCAGCCCTTGA