SecReT4
Protein ID: 226201075
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p136
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]122901..124238 [+]
ProductTraO
Component typeTraO_I
UniProt IDC1J8N6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 445 a.a.     [Download]
>gi|226201075|ref|YP_002756687.1| TraO [Escherichia coli]
MSAEQEQDTAAKSGKKLSALLVMGGVIIIGGGYLLLTWLSPENAASLSSVNINSTTSGGGRNVMETQHYR
DLLRADNERGAAEALRNNETFIASLPRGLDTDTGNDQKRDNPPDDQSGTSGQNASPPQEDQTAREKRREA
LQKLLARINTQHQDARPPVVAAAMWSTTGTPGTAPHASPPGTVTSQHPRLQETSLATPAARPGIQLIPAL
TRVPAYIDTEVDSDNAVSRVVASVPAGPWAGAVLYSQDARLAGQGMDIHFDRMMWRGMFLKVNAYALNER
TGMSTVASDVNHRWFKHIVLPSVLGGVGNVGSLYKDANTQILQGNYGSITGRVGMPDGEALAGVIAGGMA
ERGSQLLTRQAESEPYRQVTVSRGEVVSILFVEPVMSNDISTPSSGTAPSESPSSGRPLTQAEAEHQASD
RIRAAVLRKQNEMQQRYGIQQESYP
 
Nucleotide Sequence: 1338 bp     [Download]
>gi|226200948|ref|NC_012487.1|:122901-124238 Escherichia coli plasmid pO26-Vir, complete sequence
ATGAGCGCAGAACAAGAACAGGACACAGCCGCAAAATCCGGCAAAAAGCTGTCAGCCCTGCTGGTTATGG
GGGGCGTGATTATCATCGGGGGCGGATACCTGCTGCTCACCTGGCTGTCCCCCGAAAACGCTGCATCGCT
CTCGTCAGTCAATATCAACAGCACAACGTCCGGCGGCGGACGGAACGTGATGGAGACACAGCACTACCGG
GATTTACTGCGGGCTGACAATGAACGTGGTGCTGCAGAAGCGTTACGTAATAACGAGACGTTTATCGCCA
GTCTGCCCCGGGGACTGGATACCGATACCGGAAACGATCAGAAAAGGGATAATCCCCCCGATGATCAGTC
AGGCACTTCCGGGCAAAACGCATCCCCCCCTCAGGAAGATCAGACTGCCCGGGAAAAACGGCGTGAGGCA
TTACAGAAACTGCTTGCCCGTATCAATACACAGCATCAGGATGCCCGGCCACCGGTAGTGGCAGCAGCCA
TGTGGAGCACCACCGGCACTCCCGGGACAGCCCCACATGCGTCACCGCCCGGTACCGTTACATCACAACA
TCCCCGTCTGCAGGAGACGAGTCTGGCAACCCCGGCAGCACGTCCGGGGATCCAGCTGATACCGGCACTG
ACCCGCGTACCGGCCTACATTGATACCGAAGTGGACTCTGACAATGCGGTCTCCCGTGTGGTGGCCTCCG
TACCTGCCGGCCCATGGGCCGGGGCCGTCCTCTACAGCCAGGACGCCAGACTCGCAGGTCAGGGAATGGA
TATCCACTTTGACCGGATGATGTGGAGGGGCATGTTTCTGAAGGTGAATGCATATGCCCTGAATGAACGA
ACAGGAATGTCAACCGTGGCCAGCGACGTGAACCACCGCTGGTTTAAGCACATCGTTCTGCCGTCCGTAC
TTGGCGGGGTGGGCAATGTCGGAAGTCTTTACAAAGACGCCAACACACAGATCCTTCAGGGAAACTACGG
CAGTATTACCGGCAGGGTGGGAATGCCTGATGGAGAGGCGCTGGCCGGCGTCATTGCAGGTGGCATGGCC
GAACGGGGCAGCCAGCTGCTGACCCGCCAGGCAGAGAGCGAACCTTACCGTCAGGTGACAGTATCACGGG
GCGAGGTCGTCTCCATTCTGTTTGTTGAGCCGGTCATGAGCAACGATATCAGTACGCCGTCCTCCGGCAC
TGCCCCTTCTGAGTCCCCCTCCTCCGGCCGTCCGCTCACCCAGGCGGAGGCAGAGCACCAGGCCTCTGAC
AGGATCCGGGCGGCGGTCCTCCGTAAACAGAATGAAATGCAGCAACGCTACGGCATACAACAGGAAAGTT
ATCCATGA