SecReT4
Protein ID: 226201077
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p138
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]124945..125475 [+]
ProductTraQ
Component typeTraQ_I
UniProt IDB7LIR2, C1J8N8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 176 a.a.     [Download]
>gi|226201077|ref|YP_002756689.1| TraQ [Escherichia coli]
MMSIDALTAIENFASGIFSAGMEFLFTWGELLGIIGLIGHLMRARAEGRHSMGPGKFIAGIFICGMLVSL
PSMINAGGTQMGFRADSFAPIAYVQPGSFGAAAGAVNAILSLAKLAGVGFVMNGISIWRKSLLDGHTALS
ASESISKGNVKFVAGVLLVFNDRVIDATLASLGIAF
 
Nucleotide Sequence: 531 bp     [Download]
>gi|226200948|ref|NC_012487.1|:124945-125475 Escherichia coli plasmid pO26-Vir, complete sequence
ATGATGAGCATTGATGCCCTGACAGCCATAGAGAACTTTGCCAGCGGTATTTTCAGTGCAGGCATGGAGT
TTCTCTTTACCTGGGGAGAGCTGCTGGGGATTATCGGCCTTATCGGTCATCTGATGCGCGCCCGGGCAGA
AGGACGTCACAGTATGGGACCGGGAAAATTTATTGCCGGTATCTTCATCTGCGGCATGCTGGTCAGTCTG
CCCTCAATGATCAATGCCGGTGGTACCCAGATGGGCTTCAGGGCAGATTCTTTCGCCCCCATCGCATACG
TGCAGCCGGGCTCCTTTGGTGCCGCTGCCGGTGCCGTCAATGCCATTCTCTCACTGGCAAAACTGGCCGG
CGTCGGTTTTGTCATGAACGGCATATCCATCTGGCGCAAATCACTGCTGGACGGGCACACCGCCCTGAGC
GCCAGTGAATCCATCAGTAAAGGGAACGTCAAGTTTGTGGCCGGCGTTCTGCTGGTTTTCAACGACCGGG
TTATCGATGCCACTCTGGCAAGCCTCGGTATCGCCTTCTGA