SecReT4
Protein ID: 226201086
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p147
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]132925..134889 [+]
Producttruncated integral membrane protein
Component typeTraY_I
UniProt IDC1J8P7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 654 a.a.     [Download]
>gi|226201086|ref|YP_002756698.1| truncated integral membrane protein [Escherichia coli]
MVFNAIIATMGIVWFLFIGIRHAVRTGHQGSVFNNGQDVVGILSVVSGFLMIVPTASGWSLAQLVMLWGA
SIMGIGSANIMVQTAAENIAEGYSMTVQPVHVSTRTAARGILEMELCKHAMNTGLDDFNRTARSSTPPMS
ESSRTENGRYTVTVSNGSATCGSVSLSVKGNGSNKQSALAHFFNPFIETEYQGVLTAQRSAMDTMLRDLD
SAAQEFVSAYRTRRDTGNGNLPDIESRIQKAANRYEETVQKALPADNAETERREQLKSYLTTYGWVALGA
WYQTFATANQRLAELADRAPTVSGVSSLGEAGDTEFLKEVKGAYQAQLQNSAYTPALGTATSASEYHASK
TQDPQSAILKLIGFNLTRMTNWTATYLSGTGTTTNQLNPLIKMKNIGDYTMVTTETIWAGYTTVRVLSTA
GSNSVFGRLVNAVRGLSDAAKAFLEASAPPLYFLLFLLFCAGFSLSIYLPFIPFIFWITGIGNWIVSVLI
GCAAGPLWAATHLGTSQDRGSRAAYGYIYLIDSMIRPLLMVFGFFFASVAIVAGGTILSALYAAALMNVQ
INSVTGVFSMAGFLMIYARACTTLVAAVFALQAYLPDHVINFLGGRDGVNMLGNMVSSVKDIIAGGNTNM
RRTPGVREEKLKNINRDDKDGIKQ
 
Nucleotide Sequence: 1965 bp     [Download]
>gi|226200948|ref|NC_012487.1|:132925-134889 Escherichia coli plasmid pO26-Vir, complete sequence
ATGGTGTTTAACGCAATTATCGCCACGATGGGGATAGTCTGGTTTCTGTTTATTGGTATCCGTCATGCTG
TCCGCACGGGACACCAGGGCAGTGTCTTTAACAACGGACAGGACGTCGTCGGCATACTCAGTGTCGTGAG
TGGATTTTTGATGATTGTGCCCACCGCTTCCGGCTGGAGTCTGGCGCAACTGGTCATGCTGTGGGGCGCA
TCCATCATGGGCATCGGTTCCGCCAATATCATGGTTCAGACAGCGGCAGAAAACATTGCTGAAGGCTATT
CAATGACCGTACAGCCAGTACATGTCTCCACCCGCACGGCAGCACGGGGAATTCTGGAGATGGAACTGTG
CAAACACGCCATGAATACGGGCCTCGATGACTTTAACCGTACCGCACGTTCATCAACGCCGCCCATGAGC
GAATCCTCACGGACAGAGAATGGCAGATATACCGTCACCGTCTCAAATGGCAGCGCCACCTGCGGGAGTG
TGAGTCTCTCCGTGAAAGGAAACGGCAGTAACAAGCAGTCCGCGCTGGCCCATTTTTTCAATCCCTTCAT
TGAAACGGAATATCAGGGGGTTCTGACGGCACAGCGCTCCGCCATGGATACCATGCTCCGTGACCTGGAC
AGCGCGGCGCAGGAATTTGTGTCGGCATACCGGACCCGGCGCGACACGGGTAACGGCAACCTGCCGGATA
TTGAAAGCCGTATTCAGAAGGCAGCCAACCGGTATGAAGAAACGGTGCAGAAGGCGTTGCCGGCAGATAA
CGCAGAAACTGAGCGCAGGGAGCAGCTGAAATCCTACCTGACCACCTACGGCTGGGTTGCCCTGGGCGCC
TGGTACCAGACCTTTGCCACCGCCAACCAGCGACTGGCTGAACTGGCCGACCGTGCCCCTACAGTGAGTG
GCGTCTCGTCACTGGGCGAAGCCGGGGATACGGAATTCCTGAAGGAAGTCAAGGGGGCTTACCAGGCACA
GCTGCAGAACTCAGCGTATACTCCTGCACTGGGAACCGCCACCTCTGCCAGTGAATACCACGCATCTAAA
ACTCAAGACCCTCAATCAGCAATCTTAAAATTGATTGGGTTTAACCTAACAAGAATGACTAACTGGACAG
CCACTTATCTGAGCGGTACAGGTACCACAACTAATCAACTAAATCCGTTGATAAAAATGAAAAACATTGG
CGATTACACCATGGTTACGACCGAAACCATCTGGGCGGGTTATACCACCGTCAGGGTACTTTCCACGGCC
GGCAGCAACTCCGTTTTTGGTCGACTGGTCAATGCCGTCAGGGGATTATCTGACGCCGCAAAGGCTTTTC
TGGAAGCATCCGCACCACCACTCTACTTCCTGCTGTTTTTGCTGTTTTGTGCCGGTTTTTCGTTATCCAT
TTACCTGCCGTTTATCCCGTTTATCTTCTGGATAACCGGCATCGGCAACTGGATAGTCAGCGTACTGATT
GGATGTGCTGCTGGCCCCCTGTGGGCCGCCACCCATCTGGGAACAAGTCAGGACCGGGGAAGCCGAGCCG
CTTACGGTTACATCTACCTGATAGACAGCATGATCAGACCGCTGCTGATGGTGTTCGGGTTCTTTTTTGC
ATCAGTCGCCATCGTGGCCGGCGGCACAATCCTGAGTGCGCTGTATGCTGCTGCACTGATGAATGTCCAG
ATAAACTCTGTGACGGGTGTGTTCAGCATGGCGGGATTTTTGATGATTTATGCCCGCGCCTGTACCACAC
TGGTTGCAGCCGTTTTTGCGCTTCAGGCTTATCTGCCTGACCATGTAATTAATTTTCTGGGCGGACGTGA
CGGTGTTAATATGCTGGGGAATATGGTTTCTTCAGTCAAAGATATTATTGCCGGAGGTAATACCAATATG
CGCAGAACACCTGGCGTTCGTGAAGAAAAACTGAAAAATATTAATAGAGATGATAAAGACGGAATAAAAC
AATAA