SecReT4
Protein ID: 226201101
T4SS name [ID]Tra_I [167]
Gene symbol-
Locus tagp026VIR_p162
StrainEscherichia coli plasmid pO26-Vir (NC_012487)
Repliconplasmid pO26-Vir [GenBank: NC_012487] [Browse all T4SS(s) in this replicon]
Location [Strand]142428..143708 [+]
ProductTrbA
Component typeTrbA_I
UniProt IDC1J8R2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 426 a.a.     [Download]
>gi|226201101|ref|YP_002756713.1| TrbA [Escherichia coli]
MNIWYIVGTICLLFALLIWLFLPDIVFATCLILHTMWGMTDWGPFHHFAAPRYNLLAITANNAATITFGQ
WLDVMSRTVGILWLILLPMTFGFLWMWFHHPAQPRFTRRPLNIHTLPHIFSALSPAIAPVLADGDNNRLF
HGQKRPERRVALTPEVFVEQNNLIRNMQLDVASTRQCFMAQLGQPLTSWKDMAPHEKALFAIFGLQFFLG
DRKAAVALMNNLNLSCRLKSKRDQGRFSTPVYSLARNAFIRVIKTEGAQQWLRQHRYVRSGLVWLYAHDL
RLTPPNWLWLKGVDRTLFYALHRANTTKGFIEGAGVVAVARAENEASRLGLPCPEPCVEEAIEGLRRDML
GLGLIWDEPQPDRDRKRQIRTRWSLTDDVIPRRHDNDEDTDTGETTETTETTETTETTETTETTEKQHPA
DKEKEQ
 
Nucleotide Sequence: 1281 bp     [Download]
>gi|226200948|ref|NC_012487.1|:142428-143708 Escherichia coli plasmid pO26-Vir, complete sequence
ATGAACATATGGTATATCGTTGGCACCATATGTCTGCTCTTTGCGCTTCTCATCTGGCTCTTTTTACCCG
ACATCGTCTTTGCCACCTGCCTGATCCTGCACACAATGTGGGGGATGACTGACTGGGGGCCTTTTCACCA
TTTTGCCGCCCCCCGTTACAACCTGCTGGCCATCACTGCTAACAACGCGGCAACCATCACTTTCGGCCAG
TGGCTGGATGTTATGTCCCGGACAGTGGGGATCCTCTGGTTGATTCTGCTTCCCATGACATTCGGCTTTC
TGTGGATGTGGTTTCACCATCCGGCCCAGCCCCGTTTTACCCGCAGGCCACTGAATATCCACACACTGCC
CCATATTTTTTCAGCTCTGTCACCGGCGATCGCCCCCGTTCTGGCTGATGGAGACAACAACAGACTCTTC
CACGGACAAAAACGTCCCGAGCGCCGTGTCGCACTAACCCCCGAAGTCTTTGTGGAGCAGAACAACCTTA
TCCGCAACATGCAGCTCGATGTTGCGTCCACACGCCAGTGCTTCATGGCGCAACTGGGGCAACCACTGAC
CAGCTGGAAAGACATGGCCCCACATGAAAAAGCGCTCTTTGCCATCTTTGGCCTGCAGTTCTTCCTCGGT
GACCGGAAAGCAGCGGTAGCCCTGATGAACAACCTCAATCTCTCCTGCAGGCTCAAAAGTAAACGGGACC
AGGGGCGTTTCAGCACGCCGGTGTATTCACTGGCCAGAAACGCCTTTATCCGGGTCATCAAAACAGAAGG
CGCACAACAGTGGCTCAGGCAGCACCGTTACGTTCGCAGCGGTCTGGTCTGGCTTTACGCACATGATTTG
CGCCTGACGCCTCCGAACTGGCTGTGGCTCAAGGGCGTTGACCGGACGCTCTTCTATGCCCTTCACCGGG
CAAACACCACAAAAGGCTTCATCGAAGGGGCCGGCGTGGTGGCCGTTGCCCGGGCAGAAAATGAAGCCAG
CCGTCTCGGCCTCCCCTGCCCGGAACCCTGTGTGGAAGAGGCCATTGAAGGGCTTCGACGGGACATGCTG
GGGCTGGGCCTGATATGGGACGAACCTCAGCCAGATCGCGATCGTAAACGTCAGATCAGGACCCGCTGGT
CACTCACGGATGACGTGATACCCCGCCGCCATGATAACGACGAAGACACTGACACTGGTGAAACCACCGA
AACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAACCACCGAAAAACAGCATCCCGCC
GACAAGGAAAAAGAACAATGA