SecReT4
Protein ID: 238892787
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0593
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]583723..585225 [-]
Producthypothetical protein
Component typeTfc19
UniProt IDC4X2F9
KEGG IDkpu:KP1_0593
PDB IDNA
Domain hit(s) vs Pfam TraG_N [PF07916], Evalue: 6e-108, Aligned region: 8..482
Protein Sequence: 500 a.a.     [Download]
>gi|238892787|ref|YP_002917521.1| hypothetical protein KP1_0593 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MTANSYFEYVLTLLGWLVNNGVWQTLTATGLFALPLLAKLVALWLKARGQGADEGNVARLLVVWVEHSLY
SALLVILFAGVPFLSVDINTITYDSQRTKQCGWSVVQPGDSGYAPLINELSGQSASVPVWWYFTHALGKG
ITSAAVAVLPWKPDLRQLRFEVQHTLIADPALAQELQDFVNDCYGPSRTRLKRLGSDISEEQSREVDWVG
SSFYLSTPGYYDHDHSRSPRAAWPYDASRDDGLSDTGGGGYPACKEWWSDGDAGLKNRLLKQVDTTLWQR
LQKLGQSKEEYEEAVLRSLVSPRNMQVSQGGLVYNGFGGSAGDNLSQTQLLSRVGGIIGTGLSSYALFPA
FDNVRQALPMVQAFLEMALVICIPVILLFSAWELKTVITLSVVQFALFFLTFWWELARWLDNWLMQMMYD
SDTHSYFNLWGLQNTSDDLIVNIIMGVMFLVLPAFWLGALTWAGVRIGTAVAGVMGSAVGDIRSAGEQVG
KMIVSKTRLP
 
Nucleotide Sequence: 1503 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c585225-583723 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGACCGCCAACAGCTATTTCGAGTACGTGCTCACCCTGCTCGGCTGGCTGGTGAACAACGGCGTGTGGC
AGACGCTGACCGCCACCGGGCTATTCGCCCTGCCCCTGCTGGCAAAACTGGTTGCCCTGTGGCTGAAAGC
GCGCGGCCAGGGGGCGGATGAAGGCAACGTCGCCCGCCTGCTGGTCGTCTGGGTGGAGCACTCGCTCTAC
AGCGCCCTGCTGGTGATCCTCTTCGCGGGCGTACCGTTCCTGAGTGTCGATATCAATACCATTACATACG
ACAGCCAGCGCACGAAGCAGTGCGGCTGGTCGGTGGTGCAGCCCGGTGATTCCGGCTATGCGCCGTTGAT
TAATGAACTCAGCGGCCAGAGCGCCTCGGTTCCGGTGTGGTGGTACTTCACTCATGCGCTGGGCAAAGGC
ATCACTAGCGCCGCCGTCGCGGTATTACCCTGGAAACCGGACCTGCGTCAGCTGCGTTTTGAAGTGCAGC
ACACCCTGATCGCCGATCCAGCGCTGGCGCAGGAATTACAGGATTTCGTTAATGACTGCTACGGGCCGTC
GCGCACACGCCTCAAGCGGCTGGGCAGCGATATTAGCGAGGAACAGAGCCGGGAGGTGGACTGGGTGGGA
TCGTCTTTTTATCTCTCCACGCCGGGTTATTACGACCATGATCATTCCCGCTCACCCCGCGCCGCCTGGC
CTTATGACGCCAGCCGCGACGACGGTCTGAGTGATACGGGTGGCGGAGGCTATCCTGCGTGTAAGGAGTG
GTGGTCCGATGGCGATGCGGGGCTGAAAAATCGGCTACTGAAGCAGGTCGATACGACACTCTGGCAGCGG
CTGCAAAAACTGGGGCAGTCTAAAGAGGAGTATGAAGAAGCAGTGCTGCGCTCGCTGGTGAGCCCGCGCA
ACATGCAGGTGTCGCAGGGCGGGCTGGTGTACAACGGGTTTGGCGGGAGTGCGGGGGATAATCTCAGCCA
GACGCAGTTGCTCAGCCGCGTCGGCGGGATCATCGGCACGGGGCTTTCCAGCTACGCCCTGTTTCCGGCG
TTTGATAACGTCCGCCAGGCGCTGCCGATGGTGCAGGCGTTCCTCGAAATGGCGCTGGTAATTTGTATAC
CGGTAATTCTGCTGTTCTCGGCATGGGAGCTTAAAACAGTCATCACGCTGAGCGTTGTGCAGTTCGCTCT
GTTCTTTCTCACCTTCTGGTGGGAACTGGCCCGCTGGCTGGATAACTGGCTGATGCAGATGATGTACGAC
AGCGACACCCACTCGTATTTCAACCTCTGGGGCCTGCAAAACACCTCCGACGATCTGATTGTGAATATCA
TTATGGGCGTGATGTTCCTGGTGCTTCCGGCATTCTGGCTGGGGGCGCTGACCTGGGCGGGCGTCAGGAT
CGGCACAGCAGTCGCTGGGGTGATGGGCAGCGCTGTCGGTGATATCCGCAGCGCTGGCGAACAGGTCGGG
AAAATGATCGTCAGTAAAACGCGTTTACCGTAG