SecReT4
Protein ID: 238892804
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0614
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]600518..603148 [-]
Producthypothetical protein
Component typeTfc16
UniProt IDC4X2H6
KEGG IDkpu:KP1_0614
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.4e-60, Aligned region: 20..282
AAA_10 [PF12846], Evalue: 1.2e-40, Aligned region: 476..804
Protein Sequence: 876 a.a.     [Download]
>gi|238892804|ref|YP_002917538.1| hypothetical protein KP1_0614 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MNERCGLPQQALNTSYRKGPSFVDWLPWVEFLPESQTLLLEDGRSVGAVFELIPVGTEGRSTAFLEQMRD
TVTDALQDAFDEHERAPWVVQFFCQDEDDSEAWLASLSAYAAPEIRNSAFTREWLTQMANHMANLTRDEG
LFLDNTVTRTRWRATWRRTRMVVYRWLPGFSPDEPSPEETLNNICERLTAGLKAAGINAIRQNEQAIHRW
MVRWFNPAPPVEDKKAFWRQLDLPEAESLPVITDFAERLLTSEPRSDAKNGVWWLDNRPHKVMVVDRLRK
APPPGLLTGETSRGDGINALFDLLPAGTIINLTVVVYPQDKLEQHISHLADRAIGDNTDSEYTRRDCHEV
RSYLKDGHKLYRSTLAFYLHAPDTDTLFRQQRQLHSLLLNAGLVPVQEQHEVAPLSHWLRWLPMCFDPLR
DLCGLYTRLNFVQHIAGLMPVYGRETGTGHPGICYFNRGGAPLCFDPLNKLDRAQNGHLLLLGPTGAGKS
ATLNAKIAQLMALHRPRLFIIEAGNSFGLMADYAAAHGLTVNKINLRPGSGVTLPLFADAWRLVEQAVTD
AEPPEDEESDGDDQRDVLGEMEITARLMITGGEAKEDARLTRPDRAMIRQAIIAAAHTCYQEKRQTLTQD
IRDALFALSRDNSLPEARRQRAYEMAESINLFCAGFEGELFNREGQMWPETDITLVDLATFAREGYEAQL
AISYISLINHINNLGERDQHLVRPIVNITDEAHIITVNPLLARFLTKGSKMWRKLGIWLWLATQNLADFP
DEAKKLLNMIEWWELLVMPPEEIEQVCRFKALTEEQRQLLRSAVKSPGQYTEGVVLSPRVEALFRVVPPA
LYLALAMTEKHEKAERRRIMQETGCSEVEAAMKFKF
 
Nucleotide Sequence: 2631 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c603148-600518 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAATGAACGGTGCGGTCTCCCGCAACAGGCGCTGAATACCAGCTACCGCAAGGGCCCGTCCTTTGTCG
ACTGGCTGCCGTGGGTGGAGTTTTTGCCGGAGTCGCAGACGCTGCTGCTGGAAGATGGCCGCTCGGTGGG
CGCGGTGTTTGAGCTAATACCTGTTGGCACCGAAGGCCGCTCGACGGCCTTTCTCGAACAGATGCGCGAT
ACCGTCACCGACGCATTACAGGATGCCTTTGATGAGCATGAACGTGCGCCGTGGGTGGTGCAGTTTTTCT
GCCAGGACGAGGACGACAGCGAGGCGTGGCTGGCATCACTTTCAGCTTACGCCGCACCGGAAATTCGCAA
CTCCGCCTTTACCCGCGAATGGCTCACGCAGATGGCAAACCATATGGCGAATCTCACCCGCGATGAGGGG
CTGTTTCTCGATAACACCGTCACCCGTACCCGGTGGCGGGCGACGTGGCGGCGCACGCGGATGGTGGTGT
ACCGCTGGCTTCCAGGTTTCTCGCCGGACGAACCGTCCCCGGAAGAGACGCTGAACAATATCTGCGAGCG
TCTCACCGCCGGGCTGAAAGCGGCGGGAATTAACGCCATCCGCCAGAATGAACAGGCCATTCACCGCTGG
ATGGTGCGCTGGTTTAATCCTGCGCCTCCAGTGGAAGATAAAAAAGCCTTCTGGCGACAACTGGATTTAC
CGGAAGCTGAATCTCTGCCCGTTATCACCGATTTCGCTGAACGACTGCTGACGAGCGAACCGCGCTCGGA
CGCAAAGAACGGCGTTTGGTGGTTGGATAACCGACCGCATAAAGTGATGGTGGTCGACCGCCTGCGCAAA
GCGCCGCCGCCCGGCCTGCTGACCGGAGAAACCTCGCGCGGCGACGGCATCAATGCCCTGTTCGACCTGC
TGCCTGCGGGAACCATCATAAACCTGACCGTAGTGGTGTATCCGCAGGACAAGCTGGAGCAGCATATCAG
CCACCTCGCCGACCGGGCGATTGGCGACAACACCGATTCGGAATACACCCGCCGCGACTGCCACGAGGTA
CGCAGCTATCTCAAGGACGGCCATAAGCTCTACCGCAGCACGCTGGCGTTTTACCTGCATGCACCCGACA
CCGATACCCTGTTTCGCCAGCAGCGCCAGTTGCACAGCCTGTTGCTTAACGCCGGTCTGGTACCCGTACA
GGAGCAGCATGAAGTGGCCCCCTTAAGCCACTGGTTACGCTGGCTGCCGATGTGTTTCGATCCCCTGCGC
GATCTGTGCGGGCTGTATACCCGGCTCAACTTCGTTCAGCATATCGCCGGGCTGATGCCGGTGTACGGGC
GGGAAACCGGCACCGGGCATCCGGGGATTTGTTACTTCAATCGCGGCGGCGCGCCGCTGTGCTTCGATCC
GCTGAATAAGCTAGACCGCGCCCAGAACGGCCATCTGCTGTTGCTCGGCCCGACCGGAGCGGGCAAATCC
GCCACGCTGAACGCGAAAATAGCCCAATTGATGGCACTGCACCGCCCTCGCCTGTTTATCATCGAAGCCG
GGAACTCGTTCGGCCTGATGGCGGACTACGCTGCCGCCCACGGTCTGACGGTGAACAAAATCAACCTGCG
TCCCGGTTCCGGTGTCACCCTGCCCCTGTTCGCCGATGCCTGGCGACTGGTGGAACAGGCGGTCACCGAC
GCCGAACCACCGGAAGATGAAGAGAGCGACGGCGATGACCAGCGTGACGTGCTCGGTGAAATGGAGATCA
CCGCCCGGCTGATGATCACCGGTGGCGAGGCGAAAGAAGATGCACGCCTCACCCGGCCAGACAGGGCGAT
GATCCGTCAGGCGATTATCGCTGCCGCACATACCTGTTATCAGGAAAAACGCCAGACGCTAACGCAGGAT
ATCCGCGATGCACTGTTCGCCCTTTCCCGCGACAACAGCCTGCCGGAAGCCCGCCGCCAGCGGGCGTATG
AAATGGCGGAGTCCATCAACCTGTTCTGCGCCGGATTTGAAGGCGAACTGTTTAACCGTGAAGGCCAGAT
GTGGCCGGAGACGGATATAACTCTGGTCGATCTCGCCACCTTCGCCCGTGAGGGTTACGAAGCCCAGCTT
GCCATCAGCTATATCTCGCTGATTAACCATATCAATAACCTCGGCGAACGCGACCAGCATCTGGTGCGAC
CCATCGTCAATATCACCGATGAGGCGCATATCATCACTGTTAATCCCTTATTGGCGCGCTTTCTCACCAA
AGGCTCGAAGATGTGGCGCAAGCTCGGTATCTGGCTGTGGCTCGCCACCCAGAACCTGGCAGATTTTCCT
GATGAGGCGAAGAAGCTGCTCAATATGATCGAGTGGTGGGAACTGCTGGTGATGCCGCCGGAAGAGATCG
AGCAGGTCTGCCGATTTAAAGCGCTGACGGAAGAACAGCGCCAACTGCTGCGCTCAGCGGTAAAATCGCC
GGGGCAGTATACCGAGGGCGTGGTGCTGTCGCCGCGCGTGGAGGCGCTGTTTCGGGTGGTGCCGCCAGCG
CTGTATCTGGCGCTGGCCATGACTGAGAAGCATGAGAAGGCCGAGCGGAGGCGGATTATGCAGGAGACGG
GGTGTAGTGAGGTGGAGGCGGCTATGAAATTTAAGTTCTAA