SecReT4
Protein ID: 238892805
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0615
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]603145..603504 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDC4X2H7
KEGG IDkpu:KP1_0615
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 119 a.a.     [Download]
>gi|238892805|ref|YP_002917539.1| hypothetical protein KP1_0615 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MIRAILMLLFLLAGCSTSQEELMPVDPDASMLTLWQQQSGGSAALLDARAQLRRTPDGPVSQPEADTIRS
QFPRLPNPDLVLYVFPHLNGNTPVPGYSTVFPFYTRPQYALPGERLTPP
 
Nucleotide Sequence: 360 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c603504-603145 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGATACGCGCTATATTGATGCTTCTGTTTTTGCTGGCCGGATGCAGCACCTCGCAGGAGGAACTGATGC
CGGTCGATCCTGATGCCAGCATGCTGACGCTGTGGCAGCAGCAAAGCGGCGGCAGCGCAGCCCTGCTGGA
TGCCCGCGCCCAGTTGCGCCGCACGCCGGATGGTCCGGTGTCGCAACCCGAAGCGGATACCATCCGTAGC
CAGTTTCCGCGCCTGCCCAATCCGGATCTTGTGTTGTACGTTTTCCCGCACCTTAACGGCAACACCCCGG
TGCCTGGTTACAGCACCGTCTTCCCCTTCTATACCCGCCCGCAGTATGCATTACCGGGCGAACGCCTGAC
TCCGCCATGA