SecReT4
Protein ID: 238892806
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0616
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]603501..604796 [-]
Producthypothetical protein
Component typeTfc14
UniProt IDC4X2H8
KEGG IDkpu:KP1_0616
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 3.3e-05, Aligned region: 222..406
Protein Sequence: 431 a.a.     [Download]
>gi|238892806|ref|YP_002917540.1| hypothetical protein KP1_0616 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MMPRQSLLLKILLPVIVFLTVWLLLRPADKSTPEKSPSRTVAALTPQELRELGIDGDTPADTIATLVGQM
KQYRRELQSIQSDNESQQAREKRLKAQQATLASELRGDMRRQQDQMRDGLLKSQRGLLDKLDRLMAKRPD
DIPPGLGLTPGELPADVQPDIRWLEPLDAPPPVDEKLLRVPLKAADKPPPKPDVKVYTLPQNATLTGSVA
MTALIGRVPLNGTVSDPYPFKLLIGEDNLTANGIELPDVAGAVVSGIASGDWTLSCVRGQITSMTFVFHD
GTIRTVPQGGKSGNKQQEIGWLSDNQGLPCIPGERKSNAKEYLTSQFLLAGSGAAAQAFANGESTTVVED
GSITSAVTGNNGQYVLGQAIGGGLKETADWMKQHYGQMFDAVYVPPGHKVAVHLTEALAIDYEPEGRKVK
YQQASTPEGLE
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c604796-603501 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGATGCCGCGCCAGAGTCTCCTGCTGAAAATCCTGCTACCAGTGATTGTCTTTCTCACTGTCTGGCTAC
TGCTGCGCCCGGCAGACAAAAGCACGCCGGAGAAATCTCCATCCCGCACCGTGGCTGCCTTAACGCCGCA
GGAACTGCGCGAACTGGGCATTGACGGCGACACGCCCGCCGATACCATCGCCACGCTGGTCGGCCAGATG
AAGCAGTATCGTCGGGAGCTTCAGTCAATCCAGAGCGATAACGAAAGCCAGCAGGCGCGCGAGAAGCGCC
TCAAAGCACAGCAGGCGACGCTGGCATCTGAGTTACGCGGGGATATGCGCAGACAGCAGGACCAGATGCG
CGATGGACTACTAAAAAGCCAGCGAGGATTGCTGGACAAGCTCGACCGCCTGATGGCGAAACGCCCGGAC
GATATCCCGCCCGGTCTGGGGCTGACGCCCGGCGAACTGCCTGCCGATGTGCAGCCGGATATCCGCTGGC
TGGAGCCGCTGGATGCGCCCCCGCCTGTGGACGAAAAGCTGCTGCGCGTCCCCCTGAAAGCGGCGGACAA
ACCGCCGCCGAAACCTGACGTAAAAGTCTACACCCTGCCGCAGAACGCCACGCTGACCGGATCGGTGGCG
ATGACGGCGCTGATTGGTCGCGTTCCGCTTAACGGCACCGTCAGCGATCCCTACCCGTTCAAATTGCTGA
TTGGCGAGGACAACCTCACCGCCAACGGCATTGAACTGCCGGACGTGGCGGGCGCGGTGGTCTCCGGTAT
CGCCTCCGGCGACTGGACGCTCTCTTGCGTGCGCGGGCAAATCACCTCGATGACCTTTGTGTTTCACGAC
GGCACCATCCGCACCGTCCCGCAGGGCGGCAAATCCGGCAACAAACAGCAGGAGATCGGCTGGCTTTCGG
ATAACCAGGGGCTGCCGTGTATTCCCGGCGAGCGTAAGAGCAACGCGAAGGAATACCTGACCTCGCAGTT
CCTGCTGGCGGGATCCGGCGCGGCGGCGCAGGCTTTCGCCAATGGTGAAAGCACCACCGTGGTGGAGGAC
GGTAGTATCACCAGCGCGGTGACGGGCAACAATGGCCAGTACGTGCTCGGCCAGGCCATCGGCGGCGGGC
TGAAAGAAACAGCCGACTGGATGAAGCAACACTACGGCCAGATGTTCGATGCCGTGTACGTGCCGCCGGG
CCATAAGGTGGCGGTGCATCTGACTGAAGCACTGGCGATTGATTACGAGCCGGAAGGCCGAAAAGTGAAA
TACCAGCAGGCCAGCACGCCGGAGGGACTGGAATGA