SecReT4
Protein ID: 238892807
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0617
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]604793..605623 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDC4X2H9
KEGG IDkpu:KP1_0617
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 1.3e-90, Aligned region: 25..274
Protein Sequence: 276 a.a.     [Download]
>gi|238892807|ref|YP_002917541.1| hypothetical protein KP1_0617 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MGAGNRLYRCRAAASGGGGETMKSVFLVLLFSFPAFATEVVQWENIPLPVTLHVGQERIVDVGKAVRIGY
PATLEGKVRLQSAGGKVFLLANTTFPATRIQLRDTSSGELILLDIQATQSTSPLEAMQISYAPQTPATAK
TPVPVTASTEPLPVLLVRYAAQNLYAPLRTVEALPGVTPAPVRLAKRITTLLPQQPVTAIPLASWQVNAT
TVTAIRLQNRSGQRITLDPRELQGQFTAAAFQHYWLGPRGLAEDTTVAYLVTEGPVSRALLPEPKS
 
Nucleotide Sequence: 831 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c605623-604793 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGGGGGCTGGCAATCGACTGTACCGATGCCGCGCCGCAGCGTCTGGTGGCGGAGGAGAAACAATGAAAT
CTGTCTTCCTGGTTTTACTCTTCAGCTTCCCGGCCTTCGCCACGGAGGTGGTGCAGTGGGAAAACATCCC
GCTCCCAGTCACGTTGCATGTCGGGCAGGAGCGGATTGTCGACGTAGGGAAAGCGGTGCGCATCGGCTAT
CCCGCCACGCTGGAAGGCAAAGTACGTCTGCAAAGCGCGGGCGGCAAAGTCTTCCTGCTGGCGAATACGA
CGTTCCCGGCCACTCGTATCCAGTTACGCGATACCAGCAGCGGTGAGCTGATCCTGCTGGATATTCAGGC
CACCCAAAGCACTTCACCACTTGAAGCAATGCAAATTAGCTATGCGCCGCAGACGCCTGCCACAGCCAAA
ACGCCCGTCCCGGTGACAGCATCAACCGAGCCCCTGCCCGTCCTGTTGGTGCGCTACGCCGCGCAGAATC
TGTATGCGCCGCTGCGCACCGTCGAAGCCCTGCCCGGCGTCACGCCTGCGCCCGTCCGGCTGGCGAAACG
CATCACCACCTTACTGCCACAGCAGCCTGTCACCGCCATCCCGCTGGCGTCATGGCAAGTCAACGCCACC
ACCGTCACCGCCATCCGCCTGCAAAACCGTAGCGGGCAGCGCATCACGCTCGATCCACGTGAACTTCAGG
GACAGTTTACCGCCGCCGCGTTCCAGCATTACTGGCTCGGCCCGCGTGGTCTGGCAGAAGATACCACCGT
GGCTTACCTGGTGACGGAAGGTCCGGTTTCCCGCGCCCTGCTGCCGGAGCCAAAATCATGA