SecReT4
Protein ID: 238892808
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0618
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]605557..606240 [-]
Producthypothetical protein
Component typeTfc12
UniProt IDC4X2I0
KEGG IDkpu:KP1_0618
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 1.7e-82, Aligned region: 13..221
Protein Sequence: 227 a.a.     [Download]
>gi|238892808|ref|YP_002917542.1| hypothetical protein KP1_0618 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MGGTQESAMSRFRHALAERDNHILTLRAVIILLCLCLAGVGYGWYRAPQKLTLWFPPDLRSGSTRPWWEV
PPASVYAFTFYIFQQLNRWPDNGEEDYSRNLRSLRAYLTPACYTRLEHDFQVRRNGGELRERTRGVYELP
GHGYSSSVHDGDKRPFPRVETLSRDAWRVTLDVAVEEYFQNEPVKKALVRYPLQVVRYAIDAEKNPWGLA
IDCTDAAPQRLVAEEKQ
 
Nucleotide Sequence: 684 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c606240-605557 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
GTGGGTGGTACGCAGGAGTCCGCGATGAGCCGCTTTCGCCATGCGCTGGCCGAGCGCGATAACCATATAC
TGACACTGCGGGCGGTGATTATTCTGCTGTGCCTGTGTCTGGCGGGCGTCGGCTACGGCTGGTATCGCGC
GCCGCAAAAGCTCACTCTCTGGTTCCCGCCGGATCTGCGCAGCGGCAGCACCCGCCCGTGGTGGGAAGTG
CCGCCTGCCAGCGTCTACGCCTTCACCTTCTATATCTTCCAGCAGCTTAACCGCTGGCCGGATAATGGCG
AGGAGGACTATTCCCGCAACCTGCGCTCGCTACGCGCCTACCTGACGCCCGCCTGTTACACCCGGCTGGA
GCACGATTTTCAGGTGCGGCGCAACGGTGGTGAACTGCGCGAACGTACGCGCGGCGTGTATGAGCTTCCC
GGCCACGGCTACAGCAGCTCGGTGCATGACGGTGATAAGCGCCCCTTCCCGCGCGTCGAGACATTAAGCC
GGGACGCCTGGCGGGTAACGCTGGACGTGGCGGTTGAGGAGTATTTTCAGAACGAGCCGGTAAAAAAGGC
GCTGGTGCGCTACCCATTACAGGTCGTGCGTTATGCCATTGATGCGGAGAAAAACCCGTGGGGGCTGGCA
ATCGACTGTACCGATGCCGCGCCGCAGCGTCTGGTGGCGGAGGAGAAACAATGA