SecReT4
Protein ID: 238892815
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0626
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]615555..617573 [-]
Producthypothetical protein
Component typeTfc6
UniProt IDC4X2I7
KEGG IDkpu:KP1_0626
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 2.2e-15, Aligned region: 496..624
TrwB_AAD_bind [PF10412], Evalue: 1.7e-13, Aligned region: 177..224
TrwB_AAD_bind [PF10412], Evalue: 1.7e-13, Aligned region: 495..610
AAA_10 [PF12846], Evalue: 1e-12, Aligned region: 186..574
Protein Sequence: 672 a.a.     [Download]
>gi|238892815|ref|YP_002917549.1| hypothetical protein KP1_0626 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MSRYALEALLRPPVEFYSTVTAGCGALICLTQAPLLMLTLWQARLMASALMLLALRRGWQGWHIVRYHRN
LLCLPRYALTSRKIPVSRQRLFLGKGFRWLPIHTQRLYDCLQPEAARWLRPGGCYRLARHIEKRAEHTLP
RLTRLLSADRWLNPVRPLPPVGGNPWLHGVELKECDVTLPLSERPGHTLVLGTTRVGKTRLAELLATQDI
RRGEVVIVFDPKGDADLLKRLWTEAQRAGRGDRFILFHLAYPKISARYNAIGRFGRISEVASRLTGQLSG
EGNSAAFREFAWRFVNIIARALVALGQRPDYQLISRHVVNIDALFIDYARIVLPRHNARAWEVVAQLAER
VNDKNTPRHMLGRDPHVVALEQYLNAEKFYDPILDGLLSAVRYDKTYFDKIVASLLPLLEKLTTGTLAAL
LAPDYHDLDDARPILDWQQAIRQKAVVYVGLDALSDAVVAAAAGNSMFADLVSVAGHLYKFGLNDGLPGN
SEKPSPVNLHCDEFNELMGEEFIPLVNKGGGAGIQVTAYTQTLSDIQARIGSAPKAGQVVGNFNNLIMLR
VCETATAELLTKQLPQVEVRSRQVSSGVTDTPGGINSFSSNTREQVVTRNVPLLDTAALIQLPKGQAFAL
LEGGQLWKIRLPLPVADKPCPLPESVAQLAAWMQTRQQGQAE
 
Nucleotide Sequence: 2019 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c617573-615555 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAGCCGCTACGCCCTGGAGGCGCTGCTGCGCCCACCCGTGGAGTTTTACAGCACCGTCACCGCTGGCT
GTGGCGCATTAATCTGCCTGACGCAGGCCCCACTGCTGATGCTGACGCTATGGCAGGCCCGCCTGATGGC
CAGCGCCCTGATGCTGCTGGCCCTCCGACGCGGCTGGCAGGGCTGGCACATCGTGCGCTACCACCGCAAC
CTCCTGTGCCTGCCGCGCTACGCGCTCACCAGCCGGAAAATCCCGGTCAGCCGCCAGCGGCTGTTTCTCG
GTAAAGGCTTTCGCTGGCTGCCCATCCACACCCAACGGCTGTACGACTGCCTGCAACCGGAAGCCGCACG
CTGGCTGCGCCCCGGAGGGTGTTATCGCCTGGCAAGGCATATCGAAAAACGCGCCGAACATACTCTTCCC
CGTCTTACCCGGCTGCTCAGCGCCGATCGCTGGCTGAATCCGGTGCGCCCACTGCCGCCCGTTGGCGGCA
ATCCGTGGCTGCACGGGGTGGAGCTGAAAGAGTGCGACGTCACCCTGCCGCTCAGTGAACGCCCCGGCCA
CACGCTGGTGCTCGGCACCACCCGCGTCGGCAAAACCCGGCTGGCGGAACTGCTTGCCACTCAGGACATC
CGCCGTGGTGAGGTGGTAATCGTTTTCGATCCGAAAGGCGACGCGGATCTACTGAAGCGTCTGTGGACAG
AGGCGCAGCGCGCCGGACGCGGCGACCGCTTTATCCTGTTCCATCTGGCCTACCCAAAGATCTCCGCCCG
CTACAACGCGATAGGGCGCTTTGGCCGCATCTCGGAAGTGGCATCGCGCCTCACCGGACAGCTTTCCGGC
GAAGGTAACTCGGCAGCCTTCCGCGAGTTCGCCTGGCGCTTTGTCAACATCATCGCCCGCGCCCTGGTGG
CGCTCGGACAGCGCCCCGACTATCAGTTAATTTCCCGCCACGTGGTCAATATCGACGCCCTGTTTATCGA
CTATGCCCGCATCGTGCTGCCGCGCCACAACGCTCGGGCGTGGGAAGTGGTGGCGCAACTGGCGGAGCGC
GTTAACGACAAAAACACGCCGCGCCATATGCTGGGACGCGATCCTCACGTAGTGGCGCTGGAACAGTACC
TCAACGCGGAGAAATTCTACGATCCGATCCTCGACGGTCTGCTCTCGGCGGTGCGCTATGACAAAACCTA
CTTCGACAAGATTGTCGCTTCGCTGCTGCCGCTGCTGGAAAAGCTGACCACCGGTACGCTCGCCGCCCTG
CTCGCCCCGGACTACCACGATCTGGATGATGCACGCCCGATCCTCGACTGGCAGCAGGCGATCCGTCAGA
AAGCAGTGGTGTATGTCGGACTGGATGCGCTGTCTGATGCGGTGGTTGCTGCCGCCGCCGGCAATTCCAT
GTTTGCCGACCTGGTGAGCGTTGCCGGGCATCTCTATAAATTTGGCCTCAATGATGGACTGCCCGGCAAT
AGCGAAAAACCGTCGCCTGTCAACCTGCACTGCGATGAGTTTAATGAACTGATGGGGGAGGAGTTTATCC
CGCTGGTCAACAAGGGTGGCGGCGCGGGCATTCAGGTCACCGCCTACACCCAGACGCTGAGTGATATTCA
GGCCCGCATCGGCAGCGCCCCCAAGGCAGGCCAGGTGGTGGGTAACTTTAATAACCTGATTATGCTGCGG
GTGTGCGAAACCGCCACCGCCGAACTGCTGACGAAGCAACTGCCGCAGGTGGAAGTGCGCAGCCGTCAGG
TTAGCTCCGGCGTCACCGACACGCCGGGCGGCATCAACAGCTTCAGCAGCAACACACGCGAGCAGGTAGT
TACCCGCAATGTACCGCTGCTGGATACCGCCGCGCTGATCCAGCTTCCCAAAGGTCAGGCTTTTGCTCTA
CTTGAGGGTGGACAGTTGTGGAAAATTCGTCTGCCACTGCCCGTGGCGGATAAACCCTGCCCACTACCGG
AGTCCGTCGCACAACTGGCGGCCTGGATGCAGACGCGCCAGCAGGGACAGGCGGAATGA