SecReT4
Protein ID: 238892817
T4SS name [ID]Tfc [753]
Gene symbol-
Locus tagKP1_0628
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]618067..618741 [-]
Producthypothetical protein
Component typeTfc3
UniProt IDC4X2I9
KEGG IDkpu:KP1_0628
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 224 a.a.     [Download]
>gi|238892817|ref|YP_002917551.1| hypothetical protein KP1_0628 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKRLILLVLLIASVGAQPLQVQTSQNADSALQPLTMQQQAAIWGVTPEEWQRYLTLKQQARGVWSPGLDP
LTMLGVEAENDHERQRFAELLVRQEYQRLEKELAFQRAYDAAWQRLYPGLTPLKTTSASTARVSLFVQDN
CPPCDSLLRTLLAQQRSLDIWLVGSEGDDNRVRRWAMAHGIDAKLVSEHSITLNHDAGRWLLLGQSKIPV
ALERKGEQWREVQP
 
Nucleotide Sequence: 675 bp     [Download]
>gi|238892256|ref|NC_012731.1|:c618741-618067 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAAACGCCTGATTCTCCTGGTACTACTCATCGCCAGTGTGGGGGCGCAACCGCTTCAGGTGCAGACCA
GCCAGAACGCGGACTCAGCCCTGCAACCCCTGACCATGCAACAACAGGCTGCAATCTGGGGCGTCACGCC
GGAAGAGTGGCAGCGCTATCTCACGCTGAAGCAGCAGGCGCGCGGCGTCTGGTCGCCGGGGCTCGATCCG
CTAACCATGCTGGGTGTGGAGGCCGAAAACGACCATGAGCGCCAGCGCTTCGCCGAACTGCTGGTCAGAC
AGGAATACCAGCGGCTGGAGAAGGAACTCGCCTTCCAGCGCGCCTATGATGCCGCCTGGCAACGCCTCTA
TCCGGGCCTGACGCCGCTGAAAACCACGTCCGCCAGCACTGCCCGGGTTTCGCTGTTTGTCCAGGATAAC
TGCCCGCCCTGCGACAGCCTGCTGCGTACCCTGCTGGCGCAACAGCGCTCGCTGGATATCTGGCTGGTCG
GAAGCGAAGGCGATGATAACCGGGTGCGCCGCTGGGCGATGGCGCATGGCATTGATGCAAAACTGGTGAG
TGAACACAGCATCACACTTAACCACGACGCGGGACGCTGGCTCCTTTTAGGGCAGAGCAAAATCCCGGTG
GCGCTGGAGCGTAAGGGGGAGCAATGGCGCGAGGTCCAGCCCTGA