SecReT4
Protein ID: 238895544
T4SS name [ID]VirB [397]
Gene symbolvirB1
Locus tagKP1_3626
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3449225..3449935 [+]
Producttype IV secretory pathway VirB1 component
Component typeVirB1
UniProt IDA4GZF8, C4XAQ4
KEGG IDkpu:KP1_3626
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 7.4e-21, Aligned region: 9..142
Protein Sequence: 236 a.a.     [Download]
>gi|238895544|ref|YP_002920279.1| type IV secretory pathway VirB1 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MLSTTAFLAIAMQCAASIHPSTAFDVARVESGFNPYAIAEIVPKAGPSFGDQHIISHLPASRGDAEQILR
RLTAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYRRGGTLKRALSCYYSGNFSTG
QQPETAFSGTSYIQRIGYPPGSSRYAVPGTREDKSSVAVPLKTTPASDSSRHHEIWPGVVVRGVPAKLRQ
EKIFIAPFSAPSVRRSFSLSPREEEE
 
Nucleotide Sequence: 711 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3449225-3449935 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGCTTTCCACCACAGCCTTTCTGGCGATAGCCATGCAGTGCGCCGCCAGCATTCATCCGTCCACGGCAT
TCGACGTGGCACGGGTGGAATCCGGTTTTAACCCTTATGCCATCGCTGAGATTGTCCCGAAGGCCGGCCC
CTCTTTCGGCGATCAACACATTATTTCTCACCTGCCAGCCAGCCGGGGAGATGCAGAGCAGATTCTCCGT
CGCCTGACAGCACAGGATCGCCGTTACTCTGTCGGGCTGATGCAAATCACCAGCACCAATTTCCGCCATT
ATGGTGTGTCCGCCACAGAGCTACTTGATCCCTGTACCAATCTGTCCGTCTTCGAACACATTCTCAGAGA
CTGCTACCGGCGCGGCGGCACGCTGAAAAGGGCGCTGAGTTGTTATTATTCCGGCAATTTCAGTACCGGG
CAACAACCTGAAACGGCGTTTTCCGGAACGAGCTATATCCAGCGAATCGGTTATCCGCCGGGATCATCCC
GCTATGCGGTCCCCGGAACCCGTGAGGACAAATCATCAGTTGCCGTTCCCCTGAAAACCACCCCTGCCAG
TGACTCATCCCGTCACCACGAGATCTGGCCCGGAGTCGTCGTCCGTGGCGTCCCTGCGAAACTCCGCCAA
GAAAAAATCTTCATCGCACCGTTCTCCGCGCCGTCAGTGCGCCGGAGTTTCTCCCTGTCACCCCGTGAGG
AGGAGGAATAA