SecReT4
Protein ID: 238895546
T4SS name [ID]VirB [397]
Gene symbolvirB3-4
Locus tagKP1_3628
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3450241..3452979 [+]
Producttype IV secretory pathway VirB3-4 component
Component typeVirB4
UniProt IDC4XAQ6, A4GZG0
KEGG IDkpu:KP1_3628
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 5.5e-47, Aligned region: 269..470
AAA_10 [PF12846], Evalue: 1.6e-24, Aligned region: 533..822
VirB3 [PF05101], Evalue: 8.1e-09, Aligned region: 4..81
Protein Sequence: 912 a.a.     [Download]
>gi|238895546|ref|YP_002920281.1| type IV secretory pathway VirB3-4 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MAKLLKAMKRPAALWGVPMVPLLAVTGVTIIVAVWTSVALLFLLPVEFLVMKSLTRNEPMRFNLIAVWLR
VKGKPVANRLFGATTLMPVEHEAVDIKEFIDAMKLNQCATIKKYIPYSSHIHQHVVRSPKSDLYCTWELM
GTPFDCESDESLQFGTNQLHGLIHSFEGMPVTFYIHNDRNTFTDNLHKDSGNPYADEVSRLYYASVGVFR
RNRLFLTVCYRPFVSLEKAERKRMKDSQKLKELDGALLEMLEIKSTLDTALSRYGARPLGTFTEGSAVFS
SQLAFYEYLLTHQWRKVRVTRTPAYDVMGAAALFFSAESGQINHANGTQYFRGLEVKEFSEETATGMMDS
LLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSADDDAVSQRLDLDVALDLLASGKIAYGKHHFSIMV
YSPSLESLVADTNEISNALNNIGITPVPAEISLSAAYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYP
GKRDKAPWGDAMALLRTPSGDGYYINLHNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFFEIMQQKYG
REDSFSPDAKTKRLTTVYLDKDRGAEMNIRALGGRYYRVISGESTGWNPFSLPATKRNINFIKQLMKILC
TRNGSTISPRDERRLSDAVNAVMNDEPQYRVYGITRMLENLPEPATKEAQENGLSIRLSQWAQGGEFGWV
FDNESDTFDISNCDNFGIDGTEFLDDASVCAPISFYLLYRITSLLDGRRLVIFMDEFWKWLRDPVFKDFA
YNKLKTIRKLNGMLVVGTQSPAEIIKDDIAPAVIEQCGTQILAANPNADRAHYVDGMKFELEVFDVVKGL
DPQSRQYVVVKNQFKRGDTKRFAARITLDLSGIGRHTKVMSGDAPNLEIFESIYREGMQPHEWLDTYLAK
AL
 
Nucleotide Sequence: 2739 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3450241-3452979 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCAAAGCTGCTCAAGGCAATGAAACGCCCGGCGGCGCTGTGGGGGGTGCCTATGGTGCCCCTGCTGG
CTGTCACGGGTGTAACCATCATCGTTGCTGTCTGGACTTCCGTCGCACTCCTGTTCTTACTTCCCGTCGA
ATTTCTGGTGATGAAATCCCTCACCAGAAATGAACCAATGCGGTTCAATCTGATTGCCGTTTGGCTGAGA
GTGAAGGGAAAACCGGTAGCAAACCGTTTATTTGGTGCAACAACACTTATGCCCGTTGAGCATGAGGCTG
TTGATATCAAGGAGTTTATAGACGCCATGAAACTAAATCAGTGTGCCACCATCAAGAAGTATATTCCGTA
CTCATCGCACATTCATCAGCATGTGGTTCGCTCACCTAAAAGCGATCTGTACTGCACCTGGGAATTGATG
GGAACGCCGTTCGACTGCGAGTCTGACGAATCACTCCAGTTCGGGACGAACCAGTTACACGGGCTAATCC
ACTCATTCGAAGGTATGCCCGTCACTTTCTATATCCATAACGACCGCAATACGTTTACCGACAATCTTCA
TAAAGATTCCGGCAACCCGTATGCCGATGAAGTTAGCCGTCTTTACTACGCTTCTGTCGGGGTGTTCCGG
CGTAACCGCCTGTTCCTGACAGTCTGCTATCGCCCGTTTGTCAGCCTTGAAAAAGCAGAACGCAAACGGA
TGAAAGACAGCCAGAAACTAAAGGAACTGGACGGTGCTTTGCTGGAAATGCTGGAAATAAAAAGCACGCT
CGATACCGCGCTGTCGCGCTATGGTGCGCGGCCTCTCGGTACGTTTACCGAAGGAAGCGCGGTGTTTTCG
TCGCAACTGGCTTTCTATGAATATCTGCTAACGCATCAGTGGCGAAAGGTGCGCGTCACCCGCACCCCGG
CCTATGACGTGATGGGAGCGGCGGCGTTGTTCTTTTCGGCTGAATCCGGGCAGATAAACCACGCCAACGG
TACGCAATATTTCCGGGGGCTGGAGGTTAAAGAGTTCTCCGAAGAGACCGCCACGGGGATGATGGACTCC
CTTCTTTACGCCCCCTGCGATTACGTGATTACGCAGTCCTATACCTGCATGTCACGCGAGGAAGCGAAGA
AAGCCATTAAGCGTACCCGTCGCCTTTTGATGAGTGCCGACGACGATGCTGTTTCCCAGCGGCTGGATCT
GGATGTGGCGCTTGACCTGCTGGCATCGGGGAAAATCGCTTACGGAAAGCACCATTTTTCCATCATGGTG
TATTCCCCGTCGCTGGAAAGCCTGGTTGCTGATACTAACGAAATCAGTAACGCGCTGAACAACATCGGGA
TAACGCCTGTTCCGGCAGAAATATCGCTTTCAGCGGCGTATATGGCGCAACTGCCAGGCAACTACAACCT
GCGGCCACGTAAAGGGGAGCTGAGTAGCCAGAACTTTGTGGAGCTGGCCGCGCTCCATAATTTCTATCCG
GGCAAGCGCGATAAAGCCCCCTGGGGGGATGCGATGGCCTTACTGCGCACCCCGTCAGGCGATGGCTACT
ATATCAACCTGCATAACACACTGGCAGATAAGGACGAATTCAACGAAAAGAACCCGGCCAGTACCTGCAT
CCTCGGTACGAACGGTTCGGGTAAAACCATGTTGATGACGTTCTTTGAGATCATGCAGCAGAAATACGGG
CGTGAGGATAGCTTCTCCCCGGATGCCAAAACCAAACGGCTGACAACCGTTTACCTCGATAAAGACCGGG
GCGCAGAGATGAACATCCGGGCGCTGGGTGGCCGTTACTATCGGGTTATCAGTGGTGAGTCTACAGGGTG
GAACCCGTTCTCGTTGCCAGCAACCAAACGCAATATCAATTTCATCAAGCAACTGATGAAAATCCTTTGT
ACCCGCAACGGCTCGACGATCTCCCCACGCGATGAACGCCGTCTGAGTGATGCGGTTAATGCTGTGATGA
ATGACGAGCCACAATATCGCGTCTACGGCATTACCCGAATGCTGGAGAATTTGCCTGAGCCGGCTACGAA
AGAAGCCCAGGAAAACGGCCTTAGCATTCGGTTGTCACAGTGGGCGCAGGGCGGTGAGTTCGGCTGGGTG
TTTGATAACGAGTCTGACACGTTCGATATCAGCAACTGCGATAACTTCGGCATCGACGGAACGGAGTTCC
TGGACGATGCAAGCGTATGTGCGCCAATCTCGTTTTATCTGCTGTACCGCATTACCAGCCTGCTTGACGG
GCGACGCCTGGTCATTTTCATGGATGAATTCTGGAAGTGGTTACGCGACCCGGTGTTTAAGGACTTTGCT
TATAACAAGCTGAAAACCATCCGTAAGCTGAACGGGATGCTGGTCGTCGGTACTCAATCCCCGGCAGAGA
TCATCAAAGATGATATCGCCCCGGCAGTGATTGAGCAGTGCGGGACACAGATTCTGGCGGCGAACCCCAA
CGCCGACCGCGCACACTATGTTGACGGTATGAAGTTTGAGCTGGAAGTGTTCGACGTGGTGAAAGGGCTT
GACCCGCAATCCCGCCAGTATGTTGTGGTGAAAAATCAGTTCAAACGCGGCGATACCAAACGTTTTGCCG
CTCGTATCACGCTCGACCTGTCGGGTATCGGCAGACACACCAAAGTCATGAGCGGCGATGCCCCCAACCT
CGAAATATTCGAATCGATTTACCGGGAAGGAATGCAGCCTCATGAATGGCTCGATACCTACCTGGCTAAA
GCGCTCTGA