SecReT4
Protein ID: 238895547
T4SS name [ID]VirB [397]
Gene symbolvirB5
Locus tagKP1_3629
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3452997..3453701 [+]
Producttype IV secretion system VirB5 component
Component typeVirB5
UniProt IDA4GZG1, C4XAQ7
KEGG IDkpu:KP1_3629
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 3.9e-42, Aligned region: 22..216
Protein Sequence: 234 a.a.     [Download]
>gi|238895547|ref|YP_002920282.1| type IV secretion system VirB5 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MKTRFRTLILACFIASPLAHAGIPVAVDADPMRDVQWVQELKRWMETARHYQSQIQAYKDQLATATGVRD
IADFVGQAKGLKADLEKLRKPGQALNDLLLSGGSSGQFDALYEKYKIFDTCNTAQSGSYANVCKQQVINK
AIQLEQTDEVQNQVSQTLGEINSLSNRVALAKDSKESQDLANSIQLKSVMLNTLTTQWEMSVKAAEKREK
VLEAERVKQWNQQQLNAPTLKFHE
 
Nucleotide Sequence: 705 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3452997-3453701 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAAAACTCGCTTTCGTACTCTTATTCTGGCTTGTTTCATTGCAAGCCCACTGGCTCATGCTGGTATTC
CCGTCGCTGTTGATGCTGACCCTATGCGGGACGTGCAGTGGGTGCAGGAGTTAAAACGCTGGATGGAAAC
GGCCAGACACTACCAGTCACAAATACAGGCATATAAAGACCAACTGGCGACGGCCACTGGCGTTCGTGAT
ATTGCTGATTTTGTTGGCCAGGCCAAAGGCCTGAAAGCTGACCTTGAAAAGCTGCGTAAGCCCGGACAGG
CACTGAATGATTTGCTTCTCTCCGGCGGTTCCTCCGGGCAGTTCGATGCGTTGTACGAGAAGTATAAAAT
TTTCGACACCTGCAACACGGCACAATCGGGGAGTTATGCCAACGTATGCAAGCAGCAGGTCATCAACAAG
GCTATCCAGCTTGAGCAAACCGACGAGGTTCAGAATCAGGTAAGCCAGACCCTGGGGGAAATCAACAGCC
TCTCCAACAGGGTAGCGTTAGCCAAAGATTCGAAAGAATCTCAAGATCTTGCAAACAGTATTCAGCTAAA
ATCTGTCATGTTGAACACGCTTACCACCCAATGGGAAATGAGCGTGAAAGCAGCAGAGAAGCGCGAAAAA
GTGCTTGAGGCGGAGCGCGTTAAACAGTGGAATCAGCAACAGTTAAACGCGCCAACTTTAAAATTTCATG
AGTAA