SecReT4
Protein ID: 238895549
T4SS name [ID]VirB [397]
Gene symbolvirB6
Locus tagKP1_3631
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3453950..3455029 [+]
Producttype IV secretion system VirB6 component
Component typeVirB6
UniProt IDC4XAQ9, A4GZG2
KEGG IDkpu:KP1_3631
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 1.4e-49, Aligned region: 41..260
Protein Sequence: 359 a.a.     [Download]
>gi|238895549|ref|YP_002920284.1| type IV secretion system VirB6 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MAELGTFEFIDKQLIGGITQSTSGLMMEHSSMVMGLAAVSATIYIMWRGYQTLAGKLSTPMEDTMWDIMR
MAIILSFVANVSGYLDGVIDAINGLKEGFSGGDNIWQILDTLWDKAKVLGKTLHDMDNSTYVKDEGMTAQ
FYVWLGIFILMALTAFVSMVAEIMILLLSITAPIFIFCLMYGFLRPMFNNWLQNIFAAILTVLFSALSLR
VVINFMTKILAQSQAGAAQSNIVELGAQVCLAGICAAILVYISAKVAAALAGASATVSMQGLAAVGIGAA
FGAGKLAGGGLKETKRSALDNIQGWKDANAGKPGKPGGELGYNASKARKYAIEQMIARNEARRLAQRRES
AVKKFNSQV
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3453950-3455029 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGGCCGAACTCGGTACATTTGAATTTATAGATAAACAGCTAATTGGTGGTATAACTCAATCTACCAGTG
GGTTGATGATGGAACATTCATCAATGGTTATGGGGCTGGCCGCTGTGTCAGCCACCATATACATCATGTG
GCGTGGCTACCAGACGCTGGCGGGGAAGCTCTCCACGCCGATGGAAGACACGATGTGGGACATCATGAGA
ATGGCGATCATCCTGTCGTTTGTGGCTAACGTCAGTGGTTATCTCGATGGCGTGATCGATGCCATCAACG
GTTTAAAGGAGGGTTTTTCTGGAGGCGACAATATCTGGCAAATACTAGATACCTTATGGGATAAGGCAAA
AGTTTTGGGGAAAACATTACACGATATGGATAATTCCACATATGTAAAAGATGAGGGGATGACCGCTCAA
TTTTATGTATGGCTTGGGATATTTATTCTTATGGCTTTAACAGCTTTTGTTTCGATGGTCGCTGAGATAA
TGATCTTACTTCTTAGCATCACTGCGCCTATTTTTATTTTTTGCCTTATGTATGGTTTTTTGCGACCGAT
GTTTAATAACTGGTTGCAAAATATATTTGCAGCGATATTAACCGTTCTATTTTCAGCATTATCATTAAGA
GTAGTCATAAACTTTATGACTAAAATATTAGCCCAATCTCAAGCCGGAGCTGCACAGTCAAATATTGTGG
AACTAGGCGCACAGGTCTGTTTGGCTGGTATCTGTGCCGCAATACTGGTGTATATTTCCGCTAAAGTAGC
CGCAGCACTGGCCGGGGCAAGCGCTACCGTATCCATGCAGGGGCTGGCCGCTGTAGGTATCGGTGCTGCT
TTTGGTGCCGGGAAGCTGGCCGGGGGGGGACTTAAAGAAACCAAACGTTCCGCCCTGGACAACATTCAGG
GCTGGAAGGATGCGAATGCAGGTAAGCCCGGCAAGCCCGGAGGTGAGTTAGGCTATAACGCTTCTAAAGC
GCGTAAATACGCGATTGAGCAGATGATAGCCCGGAACGAAGCGCGGAGACTGGCACAGAGGAGGGAATCC
GCGGTTAAGAAGTTCAACAGCCAGGTCTGA