SecReT4
Protein ID: 238895551
T4SS name [ID]VirB [397]
Gene symbolvirB9
Locus tagKP1_3634
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3455925..3456833 [+]
Producttype IV secretory pathway VirB9 component
Component typeVirB9
UniProt IDA4GZG4, C4XAR1
KEGG IDkpu:KP1_3634
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.3e-53, Aligned region: 30..276
Protein Sequence: 302 a.a.     [Download]
>gi|238895551|ref|YP_002920286.1| type IV secretory pathway VirB9 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MMKKLTFTALALMMCGAAWGAAIPQASRYDSRVQQVIYNPQNVTVVNTKPGFMTTLVFDNDEAVISAKPG
FDEAWEATPDANRVNVRPVALTQGAPEEDGNTTQVVIPPNNRDWHTNMLVVTSKRLYNVELNVIDDKSAQ
QPAFQVSYRYPGEERDKASREATARQREWEQKQQQASVQKALNSAQTPRNWSYTQYPGKDSFNIVPDFAY
DNGRFTFVGFSPSKSIPSVTKELNGKEHVVNSGIQKKGDFTVLVIQEVTPRLVLRSGNAVVGLENSGFGK
VHAADGSTVSRQVERVEKPESR
 
Nucleotide Sequence: 909 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3455925-3456833 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGATGAAAAAGTTAACGTTTACCGCACTGGCACTGATGATGTGCGGCGCGGCATGGGGTGCGGCCATAC
CGCAGGCAAGCCGCTATGACTCCCGCGTGCAGCAGGTTATCTATAACCCGCAGAACGTCACTGTCGTTAA
CACCAAACCCGGCTTTATGACAACGCTGGTCTTTGATAACGATGAGGCGGTCATAAGCGCCAAACCTGGC
TTTGATGAGGCGTGGGAAGCCACGCCGGATGCAAACCGGGTCAACGTTCGCCCGGTCGCGCTCACGCAGG
GAGCGCCCGAAGAAGATGGCAACACAACGCAGGTCGTGATCCCCCCGAACAACCGGGACTGGCATACCAA
CATGCTGGTTGTCACCAGTAAGCGCCTGTACAACGTCGAGCTGAACGTCATCGATGATAAATCGGCACAG
CAACCCGCTTTCCAGGTGAGCTATCGCTATCCGGGCGAAGAACGGGACAAAGCGAGCCGGGAGGCGACGG
CCAGACAGCGCGAGTGGGAGCAGAAACAGCAACAAGCCAGCGTCCAGAAAGCGCTGAACTCGGCGCAGAC
GCCCCGCAACTGGAGTTACACCCAATATCCGGGCAAAGACAGTTTCAACATTGTTCCCGATTTTGCTTAC
GACAATGGCCGCTTTACGTTCGTGGGCTTCTCCCCGTCTAAGTCCATTCCTTCCGTCACCAAAGAGCTGA
ACGGCAAAGAGCATGTGGTTAACAGCGGTATCCAGAAGAAAGGCGACTTCACCGTACTGGTGATTCAGGA
GGTGACGCCCCGCCTGGTACTGCGTTCCGGTAATGCCGTTGTGGGTCTGGAAAATAGCGGATTTGGCAAA
GTACACGCCGCCGATGGTTCCACCGTATCCCGGCAGGTGGAAAGAGTGGAAAAACCAGAATCCAGGTAA