SecReT4
Protein ID: 238895552
T4SS name [ID]VirB [397]
Gene symbolvirB10
Locus tagKP1_3635
StrainKlebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Repliconchromosome [GenBank: NC_012731] [Browse all T4SS(s) in this replicon]
Location [Strand]3456877..3458127 [+]
Producttype IV secretory pathway VirB10 component
Component typeVirB10
UniProt IDA4GZG5, C4XAR2
KEGG IDkpu:KP1_3635
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.7e-50, Aligned region: 219..404
Protein Sequence: 416 a.a.     [Download]
>gi|238895552|ref|YP_002920287.1| type IV secretory pathway VirB10 component [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]
MNDENKVPVPDEAQASLAHSEDDIATLEREARAKREAELLNAQDDEEKDPVQPAVNKLKKRKRGKATAFL
AIVAVTLIFLAWGGNWVYRNILWQPTEEKKPDTAPQTNKTDYRQRNDLGMSTDTAEEEAEQQDNGQSSTG
GTGQAAPAAPPELNKASFLIRRDGSATTQNPVKTRQQEMTLTSATTTEQQDSSAATNTAAQSPGQSPAPV
RRIPYNPDLYIPENTSIPCSLDRHFVSDRAGKLRCTVTTDIWSASGNTKLIEKGTTASLLYRAIAEEGMK
HGQGRAFIIATNLRTRQPPYLDIPLVDTSAAGELGEAGVDGWIDSHFWERFGGALMVGMIPDIGAWASNS
AGKKDRNTDYTENSRQAMADMARTTLENSINIPPTLYKNQGEIINLITGEDIDFSNIYTLRLKNDR
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|238892256|ref|NC_012731.1|:3456877-3458127 Klebsiella pneumoniae NTUH-K2044 chromosome, complete genome
ATGAACGACGAAAACAAAGTGCCTGTGCCGGATGAAGCGCAGGCATCCCTGGCACACTCTGAGGATGATA
TTGCTACGCTTGAGCGGGAAGCTCGCGCTAAAAGGGAGGCCGAGCTTCTCAATGCGCAGGACGACGAAGA
GAAAGACCCGGTACAACCCGCCGTTAACAAGCTGAAAAAGCGCAAACGGGGCAAAGCAACCGCCTTTCTT
GCCATTGTCGCGGTCACGCTTATCTTCCTGGCATGGGGTGGTAACTGGGTTTATCGCAATATCCTGTGGC
AGCCTACGGAAGAAAAGAAACCGGACACAGCCCCGCAGACGAACAAAACCGATTACCGGCAGCGTAACGA
TCTAGGTATGTCCACCGATACAGCCGAAGAAGAGGCAGAGCAACAGGATAACGGCCAGAGCAGCACGGGG
GGAACAGGGCAGGCGGCTCCGGCCGCCCCGCCAGAACTCAACAAAGCCAGCTTCCTTATTCGCCGTGATG
GTTCAGCCACCACACAGAACCCGGTAAAAACCCGGCAGCAGGAAATGACGCTGACATCGGCAACGACCAC
CGAACAACAGGACAGCAGCGCGGCCACAAATACCGCCGCACAGTCGCCGGGACAAAGCCCCGCACCAGTG
CGCCGCATACCCTATAACCCTGACCTGTACATCCCGGAAAATACCTCGATCCCCTGCTCACTGGATCGCC
ACTTTGTATCTGACCGGGCAGGGAAACTTCGCTGCACGGTCACTACTGACATCTGGAGCGCCAGCGGCAA
CACGAAGCTGATAGAGAAAGGCACCACGGCATCATTACTTTACCGCGCCATAGCGGAAGAAGGTATGAAG
CACGGGCAAGGGCGGGCATTCATCATTGCGACGAATCTACGCACCCGCCAGCCGCCTTATCTCGATATCC
CGTTGGTTGATACCAGCGCGGCTGGCGAGCTGGGCGAGGCTGGCGTTGATGGCTGGATAGATTCGCACTT
CTGGGAACGGTTCGGCGGCGCGTTAATGGTCGGCATGATCCCCGATATTGGCGCATGGGCATCCAACAGT
GCGGGTAAAAAAGACCGCAATACGGACTATACGGAAAACAGCCGCCAGGCTATGGCAGATATGGCGCGTA
CTACGCTGGAGAACAGCATCAATATTCCCCCAACGCTCTATAAGAATCAGGGCGAGATCATCAACCTGAT
CACAGGCGAGGATATTGATTTTTCCAACATCTATACACTGAGGTTGAAAAATGACCGCTAA