SecReT4
Protein ID: 238898129
T4SS name [ID]Tra_I [185]
Gene symboltraI_1
Locus tagHDEF_0958
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]951752..952540 [+]
ProductTraI conjugal transfer protein
Component typeTraI_I
UniProt IDC4K519
KEGG IDhde:HDEF_0958
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 262 a.a.     [Download]
>gi|238898129|ref|YP_002923810.1| TraI conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MLWLLILTGSAWAQEPEKKPPPDITAYLNPSNPHKGMSETVHQMLTEAGHTLGFRGGKAQRAWELQGALR
HKENILSTLYDFRTLISPQGWLPPVIVSAQDIAHITDDHIRSASRIYHILSPERFVSHPPSWRPYLMAGL
STTTALPDNAVRPKNGEQRTVWRKAIEKGWSEGRESADRILEANFHRLTRDYTGILQYSTLLQQGMVTPP
RVTEQQQTVVGTPDQLILGDKIKRLKQRAQFNIDHLDWQPIITTEKKSNDGQ
 
Nucleotide Sequence: 789 bp     [Download]
>gi|238897251|ref|NC_012751.1|:951752-952540 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGCTGTGGCTACTCATCCTCACTGGGTCGGCCTGGGCTCAAGAGCCAGAAAAAAAGCCCCCGCCGGATA
TCACCGCTTACCTTAATCCCTCAAACCCACACAAAGGCATGAGTGAGACGGTGCATCAAATGCTGACAGA
AGCAGGGCACACCTTAGGATTTAGAGGCGGAAAAGCGCAGCGGGCATGGGAACTGCAAGGGGCTTTGAGA
CACAAAGAAAACATCCTCAGTACCCTCTATGATTTTCGAACCTTAATCAGCCCCCAAGGGTGGTTGCCCC
CGGTCATCGTCTCGGCTCAAGACATCGCTCATATCACAGACGATCACATCCGCTCTGCCAGCCGAATCTA
CCACATCCTGTCTCCAGAACGATTTGTGAGCCATCCGCCCAGCTGGCGTCCGTATCTGATGGCAGGCTTA
AGCACCACCACGGCGCTGCCTGACAACGCGGTACGACCGAAAAATGGCGAACAACGCACCGTTTGGCGAA
AAGCGATAGAAAAAGGCTGGTCAGAAGGACGGGAAAGCGCAGACCGGATTTTAGAAGCCAATTTTCATCG
TTTAACCCGGGATTATACAGGCATTCTGCAATATTCCACCCTGTTGCAACAAGGCATGGTGACACCCCCG
AGGGTCACAGAGCAGCAGCAAACGGTCGTGGGTACCCCAGATCAACTGATTTTAGGCGATAAAATAAAGC
GCTTAAAACAACGCGCTCAATTCAACATCGATCACCTCGATTGGCAGCCCATCATCACGACGGAGAAAAA
ATCCAATGACGGCCAATAG