SecReT4
Protein ID: 238898148
T4SS name [ID]Tra_I [185]
Gene symboltrbB
Locus tagHDEF_0979
StrainCandidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
Repliconchromosome [GenBank: NC_012751] [Browse all T4SS(s) in this replicon]
Location [Strand]971149..972081 [+]
ProductTrbB conjugal transfer protein
Component typeTrbB_I
UniProt IDC4K538
KEGG IDhde:HDEF_0979
PDB IDNA
Domain hit(s) vs Pfam Thioredoxin_2 [PF13098], Evalue: 4.5e-08, Aligned region: 174..283
Protein Sequence: 310 a.a.     [Download]
>gi|238898148|ref|YP_002923829.1| TrbB conjugal transfer protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
MHSKPFFTHLIGNLMTTRIGDADRGSVLFTCSLGKEPHFFIRQNSLIFRQKHQKDLVLFSDSESPDKAQH
LLNALTEALVRRQKTKLFWRNLFFGLSLLALLAIGSHGLLSETHTTDNTPLTRTDSASAPLLPEEHAIEK
SLMQEPSPALTTLAHNLRDAAQRKIFTVPLTTGHSRTIYVFLDPLCPHCRDLEPTLEAIGKKVNIEIFPV
SLIGKKATAEQVIPVLCASPEHRKALWHSLFDDPPLTPSASCDIGEKALAVNDKAFSAYGFRGTPQLISD
DGRPIPFSALKNEDTLSSFMNAEPQEKKDE
 
Nucleotide Sequence: 933 bp     [Download]
>gi|238897251|ref|NC_012751.1|:971149-972081 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum), complete genome
ATGCACTCAAAACCATTTTTCACACACCTCATAGGTAACCTGATGACCACTCGCATCGGTGATGCTGACC
GTGGGTCGGTGCTTTTTACATGCAGTCTTGGGAAGGAACCCCATTTTTTTATCCGCCAAAATAGTCTGAT
TTTCCGACAAAAACATCAAAAAGACCTCGTTCTCTTCAGTGACAGTGAGTCGCCGGATAAGGCACAACAT
CTTCTCAATGCGCTGACAGAGGCCTTGGTTCGGCGGCAAAAAACAAAATTGTTCTGGCGAAACCTCTTTT
TCGGCCTGAGTTTGTTGGCACTACTGGCCATTGGCAGCCACGGATTATTATCTGAAACCCACACAACAGA
CAACACCCCCCTCACCAGAACAGACTCCGCCTCAGCGCCCCTCTTACCCGAGGAACACGCCATCGAAAAA
AGTCTGATGCAAGAGCCCTCCCCCGCATTGACGACATTAGCCCACAATTTACGCGACGCCGCTCAACGGA
AAATCTTTACGGTGCCGTTGACCACAGGCCATTCTCGGACGATATACGTGTTTTTAGATCCTCTTTGCCC
CCATTGCAGGGACCTCGAACCCACCTTGGAGGCCATCGGTAAAAAGGTCAATATTGAGATTTTTCCGGTC
AGCCTGATAGGAAAAAAAGCCACCGCCGAGCAAGTGATCCCTGTGCTCTGTGCTTCACCAGAACATCGAA
AAGCATTGTGGCACTCATTATTTGATGATCCCCCCTTAACCCCCTCGGCTTCCTGTGACATCGGCGAAAA
AGCCTTGGCTGTGAACGACAAAGCCTTTTCCGCCTATGGCTTTAGGGGCACACCCCAGCTGATTTCAGAT
GATGGGCGACCCATTCCATTCAGTGCGCTCAAAAACGAGGACACTTTGTCTTCTTTTATGAACGCCGAGC
CGCAGGAGAAAAAAGATGAATAA