SecReT4
Protein ID: 238918293
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0330
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]334333..334929 [+]
Producthypothetical protein
Component typeTfc2
UniProt IDC5BCW6
KEGG IDeic:NT01EI_0330
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 198 a.a.     [Download]
>gi|238918293|ref|YP_002931807.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MKFYTRSKTLTAVLPLLLLAGCSSSPQKLQQRDAAVPTPSVAVTRNVQTVAPDEYARMPEVVRYDRYLLV
STDPMAVQRDPLSQIIDIRIPAALHPTVADALRYALKQSGYSLCAMGPANGVLYRQPLPAVQYQLGPMRL
RTALQVMAGPAWQLEVDDVQRVACHSLRDGYQLPASQLPPVLTSAKVPAPVKGGFLKK
 
Nucleotide Sequence: 597 bp     [Download]
>gi|238917983|ref|NC_012779.1|:334333-334929 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAAATTTTATACCCGTAGTAAGACCCTTACTGCTGTTCTGCCGCTACTTTTGCTGGCCGGCTGTTCCT
CTTCACCTCAGAAACTACAGCAGCGTGATGCCGCTGTGCCCACGCCTTCCGTGGCTGTCACTCGCAATGT
TCAGACCGTCGCACCTGATGAATATGCCCGAATGCCGGAGGTGGTGCGTTATGACCGTTACCTGTTGGTC
AGCACGGATCCGATGGCTGTCCAGCGTGATCCGCTGTCCCAGATTATTGATATCCGTATTCCGGCAGCAC
TGCATCCGACAGTGGCGGATGCCCTGCGCTATGCCCTGAAGCAGTCCGGCTATTCGCTTTGCGCCATGGG
ACCGGCAAACGGCGTGCTGTATCGCCAGCCACTGCCGGCCGTGCAGTATCAGTTGGGGCCCATGCGCTTG
CGTACGGCTCTGCAGGTGATGGCCGGTCCGGCCTGGCAACTGGAGGTTGATGATGTTCAACGTGTGGCTT
GTCACAGTTTGCGTGATGGGTATCAGTTACCGGCCAGCCAGTTACCGCCTGTGCTGACGTCCGCCAAGGT
ACCTGCCCCGGTTAAGGGAGGGTTTCTGAAAAAATGA