SecReT4
Protein ID: 238918295
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0332
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]335655..336359 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDC5BCW8
KEGG IDeic:NT01EI_0332
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 234 a.a.     [Download]
>gi|238918295|ref|YP_002931809.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MQLQLTFLALIMLSSQALAATDTSVVENSQTTQSQMQALQQKAGEWGLSPEDYQRYQQLMDGPRGIQSPG
LDPLSALGIEARTPAERRQYAEKWVKEEFARTQKELDFQREINAAWQRLYPDRLPVNLGNVAGVSRDTGG
RLALFVKSKDCPTCDARLSAVLSDNRPIDIYLVDSEGSDDMLRQWARTHRIPAEKVRSRQITLNHDGGRW
LRFGNGMMPVLLQQGEDGWHIAAF
 
Nucleotide Sequence: 705 bp     [Download]
>gi|238917983|ref|NC_012779.1|:335655-336359 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGCAACTGCAACTGACCTTTTTGGCGTTGATCATGCTGAGCTCTCAGGCTCTGGCGGCCACGGATACCT
CCGTAGTTGAAAATTCGCAAACCACACAGAGCCAGATGCAGGCCCTGCAGCAGAAGGCCGGAGAGTGGGG
ACTCAGCCCGGAGGATTACCAGCGGTATCAGCAACTGATGGATGGCCCCCGGGGTATCCAGTCCCCGGGG
CTGGATCCGCTGTCGGCGCTAGGGATTGAGGCCCGCACACCGGCAGAGCGCCGTCAGTATGCGGAAAAAT
GGGTTAAAGAGGAATTTGCCCGTACGCAAAAAGAACTGGATTTCCAGCGGGAAATCAATGCGGCATGGCA
ACGGCTTTATCCGGATAGACTGCCGGTGAATCTGGGGAATGTTGCCGGTGTTTCCCGGGATACCGGGGGG
CGTCTGGCGTTGTTCGTTAAGTCGAAAGACTGTCCGACCTGCGATGCGCGGCTGTCTGCAGTACTCAGTG
ATAATCGTCCGATTGATATTTACCTGGTCGACAGTGAGGGGAGTGATGACATGTTACGCCAGTGGGCTCG
CACTCACCGTATCCCGGCGGAAAAAGTCCGTTCCCGACAGATTACGCTGAACCATGACGGTGGGCGCTGG
TTGCGTTTCGGCAACGGAATGATGCCAGTGTTATTGCAACAGGGGGAGGATGGATGGCATATCGCCGCAT
TCTGA