SecReT4
Protein ID: 238918297
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0334
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]337003..337515 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDC5BCX0
KEGG IDeic:NT01EI_0334
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 5.3e-48, Aligned region: 23..164
Protein Sequence: 170 a.a.     [Download]
>gi|238918297|ref|YP_002931811.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MKKLLLMICLFLPLMGYAGLNVIADLGGEDASPYFDGINKQPDLLEASTATTLPPVSDMAAMFPVSTPEM
APGVVADRPLQLPGIGALFLIGDDVLSRSWLAENAQTLTDRHAVGMIISVDSASAVQSLRSLAPGVPMAP
ASGSELARRLQLRHYPVLISDTGLSRQVRP
 
Nucleotide Sequence: 513 bp     [Download]
>gi|238917983|ref|NC_012779.1|:337003-337515 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAAAAAGCTGCTTTTAATGATATGTCTCTTCCTTCCCCTGATGGGCTATGCCGGGTTGAATGTTATCG
CTGATCTGGGAGGGGAGGATGCCTCGCCTTACTTTGATGGTATTAATAAACAACCCGACCTACTGGAGGC
GTCGACAGCAACCACACTGCCACCGGTTTCTGATATGGCTGCAATGTTTCCGGTCAGCACGCCGGAGATG
GCGCCAGGGGTGGTGGCGGATCGTCCGTTGCAGTTGCCGGGCATAGGTGCGCTTTTCCTGATCGGTGACG
ACGTTCTGTCGCGATCCTGGCTGGCGGAGAACGCGCAGACGCTGACGGACCGACATGCGGTCGGCATGAT
TATCAGTGTTGACAGCGCGTCGGCAGTTCAGTCATTGCGCTCCTTGGCTCCTGGCGTTCCGATGGCACCG
GCATCCGGCTCTGAGCTGGCCCGCCGGTTGCAGTTGCGGCATTACCCGGTTCTGATCTCAGATACCGGAT
TGTCCCGGCAGGTACGGCCATGA