SecReT4
Protein ID: 238918299
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0336
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]338710..340563 [+]
Producthypothetical protein
Component typeTfc6
UniProt IDC5BCX2
KEGG IDeic:NT01EI_0336
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 1.8e-15, Aligned region: 423..552
TrwB_AAD_bind [PF10412], Evalue: 2.8e-11, Aligned region: 107..146
TrwB_AAD_bind [PF10412], Evalue: 2.8e-11, Aligned region: 423..562
AAA_10 [PF12846], Evalue: 2e-09, Aligned region: 108..499
Protein Sequence: 617 a.a.     [Download]
>gi|238918299|ref|YP_002931813.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MSAGQIPVSGQRLFLGRGFRWTQKHTQRLQDTLRPEVAKYLQPGRLYLAARWLEMKTEHSAPGLGKLLRT
DSPLNPVRPLPPVGGNPVLHGIEPDEQDVWLALLERVGHTIVYGTTRVGKTRLAELLVTQDIRRGEVTIV
FDPKGDADLMKRVWAEAHRADRGDALYIFHLGWPEISARYNAVGRFGRVSEVASRVAGQLSGEGNSAAFR
EFAWRFVNIIARALVALGERPDYTLIMRYVNNIADLYIRYAEKVIREQLPSLQAQIQNNEQVLGDDDVPR
NMQGQPDAVRIWSIEVALSSEEGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTTGKTAELLAP
DYLEMSDSRPIFDWEQIIRKKAVVYIGLDALSDSEVASAVGNSMFADLVSVAGHIYKHGIHAGLPGEGES
KVPVNLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSSDIEARIGNAAKTAQVQGNFNNLIMLRVRE
NRTAELLTTQLPQVEIYTKTLVSGHQDTDISAGQDFTSSTQDRVGTVKVPLLEPADVVTLPKGQAFALLE
GGQLWKIRMPLPADDADDTLMPQSIAKIAEEMRRNYHSGEAWWNDAPGIVPAGGVRG
 
Nucleotide Sequence: 1854 bp     [Download]
>gi|238917983|ref|NC_012779.1|:338710-340563 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAGCGCCGGGCAGATACCGGTCAGTGGTCAGCGCCTGTTTTTGGGGCGCGGGTTTCGCTGGACACAAA
AACATACCCAGCGACTGCAGGATACGCTGCGCCCGGAAGTGGCGAAGTACCTGCAGCCGGGTCGGCTATA
TCTGGCCGCTCGCTGGCTGGAAATGAAGACGGAGCATTCAGCGCCGGGTCTGGGAAAACTGCTGCGCACG
GATTCGCCCCTGAACCCGGTTCGCCCGCTGCCGCCGGTTGGTGGTAATCCGGTGCTGCACGGCATAGAGC
CGGATGAGCAGGATGTCTGGCTGGCGTTGCTGGAGCGTGTCGGGCATACCATCGTCTATGGCACCACCCG
TGTGGGAAAAACACGCCTGGCGGAGCTGCTGGTTACCCAGGATATTCGTCGCGGTGAAGTCACCATTGTT
TTTGATCCGAAGGGCGATGCCGATCTGATGAAGCGCGTCTGGGCTGAAGCACACCGTGCCGACAGGGGGG
ATGCGCTGTATATTTTCCATCTGGGCTGGCCTGAAATCTCCGCCCGCTATAACGCTGTCGGACGTTTTGG
CCGGGTGTCAGAAGTGGCGTCCCGCGTGGCGGGCCAACTGTCGGGGGAGGGGAACAGCGCGGCGTTCCGT
GAGTTTGCCTGGCGGTTTGTCAACATTATCGCCCGGGCCCTGGTAGCACTGGGTGAGCGTCCGGATTACA
CGCTGATTATGCGGTATGTGAACAATATCGCCGATCTGTATATCCGTTATGCAGAGAAGGTTATCCGTGA
GCAGCTTCCCTCACTGCAGGCACAAATTCAGAATAACGAGCAGGTTCTGGGGGATGACGATGTTCCACGG
AATATGCAGGGGCAGCCGGATGCGGTGCGCATATGGTCCATAGAGGTGGCGCTCAGCTCGGAAGAGGGAA
AGCAGCTGTATGATCCCATTCTGGATGGTCTGCGTAGCGCAGTACGCTATGACCGTACCTATTTTGATAA
AATTGTGGCCTCCCTGCTGCCTCTGCTGGAGAAACTGACAACCGGGAAAACCGCAGAGTTGCTGGCGCCG
GATTATCTGGAGATGAGCGATTCACGGCCGATTTTTGACTGGGAGCAGATAATCCGCAAAAAGGCAGTGG
TGTATATTGGCCTTGATGCACTCAGCGACAGTGAAGTGGCCAGCGCCGTGGGGAATTCCATGTTCGCCGA
TCTGGTGAGCGTGGCCGGTCATATCTACAAGCATGGTATTCATGCCGGACTGCCGGGAGAGGGTGAGAGC
AAGGTTCCGGTTAACCTGCATTGTGATGAATTTAATGAGTTGATGGGTGATGAATTTATCCCGCTTATTA
ACAAAGGGGGCGGCGCCGGTATGCAGGTAACCGCTTATACCCAGACCTCATCGGATATTGAGGCCCGGAT
CGGTAATGCGGCCAAAACGGCTCAGGTCCAGGGCAACTTCAACAATCTGATTATGTTACGTGTCAGGGAG
AACCGTACCGCTGAGCTCCTGACTACGCAATTGCCGCAGGTAGAGATTTACACCAAGACGCTGGTCTCTG
GCCATCAGGATACCGATATCAGTGCGGGTCAGGATTTTACCTCCAGTACGCAGGATCGTGTCGGGACGGT
CAAAGTACCGTTGCTAGAGCCGGCTGATGTGGTAACACTACCGAAAGGGCAGGCGTTCGCCCTGCTGGAA
GGCGGGCAACTGTGGAAAATCCGTATGCCGCTGCCTGCCGACGATGCGGATGATACACTGATGCCGCAGA
GCATTGCGAAAATTGCCGAGGAAATGCGCCGCAATTACCACAGTGGTGAGGCGTGGTGGAATGATGCGCC
GGGCATCGTGCCTGCAGGAGGTGTGCGTGGCTGA