SecReT4
Protein ID: 238918306
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0343
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]343474..344133 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDC5BCX9
KEGG IDeic:NT01EI_0343
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.5e-92, Aligned region: 5..203
Protein Sequence: 219 a.a.     [Download]
>gi|238918306|ref|YP_002931820.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MSRFRHAVKDRDQHILTLRIVCGVLAFFLLITCAGWMLAPNKLTVHNPPDLRAGSTRPWWEVPASSVYSF
AFYIFQQLNAWPKNGEVDYPAKIHALSAYLTPGCQDYLNTEARKRSNTGQLTDRVRVVYEIPGRGYQSKS
VSVISRDNWVVRLDLVADEYFHAEPVKRALVRYPLKVVRWEGDAERNPFGLALDCYDGVPQRLEAALPTE
IPAKPGVFQ
 
Nucleotide Sequence: 660 bp     [Download]
>gi|238917983|ref|NC_012779.1|:343474-344133 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAGCCGTTTTCGTCATGCGGTCAAAGACCGGGATCAGCATATTCTGACACTGCGTATTGTCTGCGGTG
TGCTGGCCTTTTTCCTGTTAATCACCTGTGCCGGCTGGATGTTGGCCCCAAATAAACTGACCGTCCATAA
CCCGCCGGATTTACGTGCCGGAAGCACCCGCCCCTGGTGGGAAGTACCGGCATCGTCGGTCTACTCCTTC
GCCTTCTATATTTTCCAGCAACTTAATGCCTGGCCTAAAAATGGTGAAGTGGATTATCCGGCAAAAATTC
ATGCGTTGTCAGCCTATCTGACCCCCGGTTGCCAGGACTATCTGAATACCGAGGCCAGGAAAAGAAGCAA
CACTGGTCAGCTGACTGACCGTGTTCGTGTGGTGTATGAAATTCCCGGTCGTGGCTATCAGTCGAAGAGC
GTCAGCGTTATCAGCAGAGATAACTGGGTGGTACGTCTCGACCTGGTGGCGGATGAGTATTTTCATGCTG
AACCGGTAAAGCGTGCCTTGGTCCGCTATCCACTAAAAGTGGTGCGCTGGGAGGGGGATGCTGAACGCAA
TCCGTTTGGTCTGGCGCTGGACTGTTATGACGGTGTGCCGCAGCGTCTGGAGGCGGCACTGCCAACGGAA
ATTCCCGCGAAACCAGGAGTGTTTCAGTAA