SecReT4
Protein ID: 238918307
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0344
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]344133..345062 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDC5BDH0
KEGG IDeic:NT01EI_0344
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 3e-117, Aligned region: 15..301
Protein Sequence: 309 a.a.     [Download]
>gi|238918307|ref|YP_002931821.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MKTRNDIRTGLMVLSLLLLPLVSLVSEPAQADEFMKWERIPLQIPLQVGLERVVFVDKNVRVGFPPALNG
KLRVQSTGGAVYLKADSTFPQTRVQLQDVESGEVILLDVTAGEKGPSEPVRLVYSGEVNTVSSTTDTRRQ
AENSDSSIQPGSDVGTQAKRKKVSYGAPIPVLLTRYAAQSLYAPLRTVEAVPGIRPVNPHLPKRLTTLYP
SEAITATPLAAWGVANRVVVAVRLQNTASLRIVLDPRALQGQFVAATFQHRWLGPVGTPEDTTTVYIVTG
MRPESAFIAEPSVVRKAVRTAKKEISHAD
 
Nucleotide Sequence: 930 bp     [Download]
>gi|238917983|ref|NC_012779.1|:344133-345062 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGAAGACCCGTAATGATATACGAACAGGGCTGATGGTGCTGTCCCTGTTGCTGTTGCCGCTGGTCTCTC
TGGTCAGCGAACCGGCACAGGCCGATGAGTTTATGAAATGGGAGCGTATTCCGTTGCAAATCCCGCTGCA
GGTAGGGCTGGAACGGGTGGTGTTTGTGGATAAAAATGTCCGGGTGGGTTTTCCTCCGGCACTTAACGGT
AAGCTGCGCGTGCAGAGTACCGGTGGAGCCGTCTACTTGAAGGCCGATAGCACTTTTCCTCAGACTCGGG
TGCAACTGCAGGATGTGGAAAGCGGTGAGGTTATTCTTCTCGATGTTACTGCTGGTGAAAAAGGCCCTTC
CGAGCCAGTTCGTCTGGTCTACAGCGGTGAGGTGAATACGGTCAGCAGTACGACCGATACCCGTCGCCAG
GCAGAGAACAGCGACAGCAGCATCCAGCCGGGCAGTGATGTCGGTACGCAGGCGAAGCGTAAAAAGGTAT
CGTACGGTGCCCCCATTCCGGTATTGCTGACCCGCTATGCCGCACAAAGCCTGTATGCGCCGCTGCGCAC
GGTAGAAGCCGTGCCGGGTATCCGCCCGGTGAATCCGCATCTGCCCAAACGGTTGACAACGCTGTATCCG
TCTGAAGCCATAACGGCCACGCCGCTGGCCGCCTGGGGCGTGGCAAATCGCGTCGTGGTGGCCGTCCGTC
TGCAAAACACCGCCAGCCTCAGGATTGTTCTGGATCCCCGTGCCCTGCAGGGACAGTTTGTGGCGGCTAC
GTTTCAGCACCGCTGGTTGGGGCCTGTGGGCACGCCGGAAGATACCACCACGGTCTATATTGTGACGGGT
ATGCGGCCGGAGAGCGCCTTCATCGCTGAGCCTTCCGTGGTGCGCAAGGCTGTTCGTACCGCGAAGAAGG
AGATCAGCCATGCAGATTAA