SecReT4
Protein ID: 238918308
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0345
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]345052..346566 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDC5BDH1
KEGG IDeic:NT01EI_0345
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 504 a.a.     [Download]
>gi|238918308|ref|YP_002931822.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MQIKSNAMVKFIVPAVVVAGLVVGLKSCKGERLPENAENASGDVTTVLKNLSQDELKALGVEGDTPEDTL
RMLIGRLNDVRDRQKTLDKQNTDLLKENEQLRKRGTNVSGQVDEAVQGLREEYDKRQQQLQNEQTSLLEK
VQTLSEQLKTTVSSSAGAKQASDSDIPLGLGLDGLGGRTRGIATRGDDGLMWVTPDDQKDVDPRDAASGK
ASPQFPTSFLDSNPLTRQKAAYEQQVKGHTGEKGAQENAEPVYTLPENSTLVGSRAMTALLGRIPLNGTV
TDPYPFKVLIGKDNLTANGIELPDVEGAIVSGSASGDWTLSCVRGQVNSITFVFADGTVRTVPQPEASGK
STGNGNTQNKTGTDGGIGWISDDDGIPCISGTRKSNASTYLPTIFALSAAGAAGEAFGEGQYTTQNNVNG
ISSTLTGSAGEAALGKALSGGMSETTDWVKQRYGQTFDAIYVPPGAKLAVHITRQLAIDYEDNGRRVRYD
FTLPGGVSDNGGLD
 
Nucleotide Sequence: 1515 bp     [Download]
>gi|238917983|ref|NC_012779.1|:345052-346566 Edwardsiella ictaluri 93-146 chromosome, complete genome
ATGCAGATTAAGTCCAATGCCATGGTGAAATTTATTGTTCCCGCAGTGGTGGTGGCGGGTCTGGTTGTGG
GCCTGAAAAGCTGTAAGGGAGAACGGCTACCTGAGAATGCTGAGAATGCATCGGGTGATGTGACGACGGT
ACTGAAAAATCTCTCGCAGGATGAGCTTAAGGCGCTCGGGGTGGAGGGTGACACGCCGGAAGATACCCTG
CGTATGCTGATAGGCCGGCTGAACGATGTGCGTGATCGCCAGAAAACGCTGGATAAGCAGAATACCGATC
TGCTGAAAGAGAATGAGCAACTGCGTAAGCGCGGCACGAATGTATCCGGTCAGGTTGACGAGGCAGTACA
GGGGTTGCGTGAAGAGTATGACAAACGTCAGCAGCAACTGCAGAACGAACAGACCAGCCTGCTGGAAAAA
GTGCAGACGCTGTCTGAACAGCTGAAAACCACCGTCAGTAGTTCAGCGGGTGCAAAACAGGCTTCTGACA
GCGATATTCCCCTGGGCCTCGGTCTGGATGGTCTGGGGGGCCGCACCCGTGGTATCGCCACCCGGGGCGA
TGACGGGCTGATGTGGGTGACGCCTGACGATCAAAAAGACGTCGATCCGCGCGATGCTGCCAGCGGTAAG
GCTTCACCGCAGTTTCCCACCTCGTTTCTGGACAGCAATCCCCTGACCCGGCAGAAAGCGGCTTATGAGC
AGCAGGTTAAGGGTCATACCGGTGAAAAAGGGGCTCAGGAAAACGCAGAGCCTGTCTATACCCTGCCGGA
AAACTCCACCCTGGTGGGAAGCCGGGCAATGACGGCATTGCTGGGCCGTATTCCGCTCAACGGCACTGTG
ACCGATCCGTATCCATTCAAGGTGCTAATTGGTAAAGATAATCTCACGGCTAATGGTATTGAACTACCGG
ATGTGGAGGGGGCGATTGTTTCCGGCAGCGCCAGCGGAGACTGGACGCTCTCCTGCGTTCGGGGGCAGGT
GAACAGCATCACCTTTGTTTTTGCTGACGGTACGGTCCGTACCGTGCCTCAACCGGAAGCCAGCGGGAAA
AGCACCGGTAATGGCAATACGCAGAATAAAACCGGTACCGACGGCGGTATTGGCTGGATTTCAGATGATG
ATGGTATTCCGTGTATCAGCGGTACCCGCAAGTCTAACGCGTCAACGTATCTGCCCACTATCTTTGCTCT
TTCTGCCGCCGGGGCCGCCGGGGAAGCATTCGGTGAAGGGCAATATACCACCCAGAACAATGTAAACGGG
ATTTCCTCCACGCTGACCGGCAGTGCCGGCGAAGCGGCGCTGGGGAAAGCCCTCTCCGGTGGCATGAGTG
AGACAACCGACTGGGTTAAGCAGCGCTATGGACAGACATTTGACGCGATTTATGTACCACCGGGTGCGAA
GCTGGCCGTACATATTACCCGCCAGCTTGCCATTGACTATGAAGATAACGGTCGCAGGGTTCGCTACGAT
TTCACCCTCCCGGGTGGGGTCAGCGACAACGGCGGTCTGGACTAA