SecReT4
Protein ID: 238918309
T4SS name [ID]Tfc [717]
Gene symbol-
Locus tagNT01EI_0346
StrainEdwardsiella ictaluri 93-146
Repliconchromosome [GenBank: NC_012779] [Browse all T4SS(s) in this replicon]
Location [Strand]346756..346998 [+]
Producthypothetical protein
Component typeTfc15
UniProt IDC5BDH2
KEGG IDeic:NT01EI_0346
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 80 a.a.     [Download]
>gi|238918309|ref|YP_002931823.1| unnamed protein product [Edwardsiella ictaluri 93-146]
MRRPLTDNEQRKGTQDDRSYSRTQESEISQQFSRLPNPDMVMYLYSHLAGGNTPVPGYSTVFPFYSQTQY
AMPGERTEAL
 
Nucleotide Sequence: 243 bp     [Download]
>gi|238917983|ref|NC_012779.1|:346756-346998 Edwardsiella ictaluri 93-146 chromosome, complete genome
TTGCGCCGCCCGTTAACTGACAATGAACAGCGGAAAGGTACACAGGACGATCGCAGCTACAGCCGCACGC
AGGAGAGTGAAATTTCACAACAGTTCTCTCGTTTGCCCAATCCCGACATGGTGATGTACCTGTATTCCCA
TCTGGCTGGCGGCAACACACCAGTGCCTGGCTACAGCACAGTATTTCCTTTCTACAGCCAGACGCAGTAT
GCGATGCCTGGTGAACGTACGGAGGCGCTGTAA